KEGG   Danio rerio (zebrafish): 192302Help
Entry
192302            CDS       T01004                                 

Gene name
hdac1, chunp6919, hdac-1, mp:zf637-2-001987, wu:fb19h11, wu:fi06f03, zgc:101582, zgc:65818
Definition
histone deacetylase 1 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    192302 (hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    192302 (hdac1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     192302 (hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 480 aa AA seqDB search
MALSSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
NAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIKNVARCWTFETAVALDSTIPNELPYNDYFEYFGPDFKLHISPFNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEDDPDKRISIRAHDKRIACDEEF
SDSEDEGQGGRRNAANYKKPKRVKTEEEKDGEEKKDVKEEEKASEEKMDTKGPKEELKTV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagttctcaaggaacaaagaagaaagtttgctattattatgacggggatgtc
gggaattactactatggtcagggccatcccatgaagccccacagaatccgcatgacccac
aaccttctgctcaactatgggctgtataggaaaatggagatttatcgacctcataaagcc
aatgcggaagaaatgaccaagtaccacagtgacgactacatcaagttcctccgctccatc
cgcccagacaacatgtccgagtacagcaagcagatgcagagatttaacgtaggggaggat
tgtcctgtctttgacggcttatttgagttctgtcagctctcaacaggtggatctgttgct
ggtgctgtgaaactcaacaaacagcagacagacattgccattaactgggcaggaggtcta
catcatgctaagaaatcagaggcatctggattctgctatgtcaacgacattgtactggcc
attctggagctgctcaagtaccatcaaagagtgctttacatcgacattgacattcatcac
ggtgatggagttgaggaagccttttacacaacagaccgtgtcatgactgtgtctttccac
aagtatggagagtatttcccgggtactggagacctcagagatattggtgcaggcaagggg
aagtattacgctgtaaattacccgctcagggatggtattgatgatgagtcctatgaagcc
atattcaaacctatcatgtccaaagtgatggagatgtaccagcccagtgctgtggtgctc
cagtgcggcgctgactctctgtccggagatcgattgggctgctttaaccttaccattaaa
ggtcatgccaagtgtgtagagtacatgaagagctttaacctgccgctgctcatgctggga
ggtggaggctacaccattaaaaacgtggcccgctgctggactttcgagacagctgtagca
ctggacagcaccattcctaatgagctcccgtacaatgattactttgagtattttggacct
gacttcaaacttcacatcagccccttcaacatgaccaatcaaaacacaaatgactacctg
gaaaagatcaagcagcgtctgtttgagaatctgcggatgttgcctcatgctccaggcgtt
cagatgcaggccatcccggaggatgcagttcaggaagacagcggagatgaagaggacgac
cctgacaaacgcatctccattcgtgctcacgataagcggatagcctgtgatgaagagttc
tcagactctgaggatgaaggccagggtggacggagaaacgcagccaattacaagaagcca
aaacgagtgaagactgaagaagagaaggatggagaagagaagaaagatgttaaagaagag
gagaaagcttcagaagagaaaatggacacaaaggggccaaaagaagaattaaaaacagtg
tga

DBGET integrated database retrieval system