KEGG   Danio rerio (zebrafish): 192302Help
Entry
192302            CDS       T01004                                 

Gene name
hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04110  Cell cycle
dre04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    192302 (hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    192302 (hdac1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     192302 (hdac1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     192302 (hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     192302 (hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    192302 (hdac1)
  Chromatin remodeling factors
   NuRD complex
    192302 (hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 192302
NCBI-ProteinID: NP_775343
ZFIN: ZDB-GENE-020419-32
Ensembl: ENSDARG00000015427
Vega: OTTDARG00000034709
UniProt: Q8JIY7
Position
19
AA seq 480 aa AA seqDB search
MALSSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
NAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIKNVARCWTFETAVALDSTIPNELPYNDYFEYFGPDFKLHISPFNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEDDPDKRISIRAHDKRIACDEEF
SDSEDEGQGGRRNAANYKKPKRVKTEEEKDGEEKKDVKEEEKASEEKMDTKGPKEELKTV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagttctcaaggaacaaagaagaaagtttgctattattatgacggggatgtc
gggaattactactatggtcagggccatcccatgaagccccacagaatccgcatgacccac
aaccttctgctcaactatgggctgtataggaaaatggagatttatcgacctcataaagcc
aatgcggaagaaatgaccaagtaccacagtgacgactacatcaagttcctccgctccatc
cgcccagacaacatgtccgagtacagcaagcagatgcagagatttaacgtaggggaggat
tgtcctgtctttgacggcttatttgagttctgtcagctctcaacaggtggatctgttgct
ggtgctgtgaaactcaacaaacagcagacagacattgccattaactgggcaggaggtcta
catcatgctaagaaatcagaggcatctggattctgctatgtcaacgacattgtactggcc
attctggagctgctcaagtaccatcaaagagtgctttacatcgacattgacattcatcac
ggtgatggagttgaggaagccttttacacaacagaccgtgtcatgactgtgtctttccac
aagtatggagagtatttcccgggtactggagacctcagagatattggtgcaggcaagggg
aagtattacgctgtaaattacccgctcagggatggtattgatgatgagtcctatgaagcc
atattcaaacctatcatgtccaaagtgatggagatgtaccagcccagtgctgtggtgctc
cagtgcggcgctgactctctgtccggagatcgattgggctgctttaaccttaccattaaa
ggtcatgccaagtgtgtagagtacatgaagagctttaacctgccgctgctcatgctggga
ggtggaggctacaccattaaaaacgtggcccgctgctggactttcgagacagctgtagca
ctggacagcaccattcctaatgagctcccgtacaatgattactttgagtattttggacct
gacttcaaacttcacatcagccccttcaacatgaccaatcaaaacacaaatgactacctg
gaaaagatcaagcagcgtctgtttgagaatctgcggatgttgcctcatgctccaggcgtt
cagatgcaggccatcccggaggatgcagttcaggaagacagcggagatgaagaggacgac
cctgacaaacgcatctccattcgtgctcacgataagcggatagcctgtgatgaagagttc
tcagactctgaggatgaaggccagggtggacggagaaacgcagccaattacaagaagcca
aaacgagtgaagactgaagaagagaaggatggagaagagaagaaagatgttaaagaagag
gagaaagcttcagaagagaaaatggacacaaaggggccaaaagaagaattaaaaacagtg
tga

DBGET integrated database retrieval system