KEGG   Danio rerio (zebrafish): 192309Help
Entry
192309            CDS       T01004                                 

Gene name
tpi1a, DrTPI-A
Definition
triosephosphate isomerase 1a (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dre00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dre00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 248 aa AA seqDB search
MSSRKFFVGGNWKMNGDKESLGELIMTLNTASLNDKTDVVCGAPSIYLDYARSKLDQRIG
VAAQNCYKVPKGAFTGEISPAMIKDCGIDWVILGHSERRHVFGESDELIGQKVAHCLESD
LGVIACIGEKLEEREAGTTEDVVFEQTKVIADNVKDWTRVVLAYEPVWAIGTGKTASPEQ
AQEVHEKLREWLRANVSDAVADSVRIIYGGSVTGGNCKELAAQADVDGFLVGGASLKPEF
VDIINARS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaggaaattcttcgtcggaggaaactggaaaatgaacggcgataaagagtct
ctgggcgagctcataatgaccttgaacacggccagtctcaacgataaaacagatgtagtt
tgtggagcaccgtccatctatttggattacgccaggtctaaactggaccagaggattggt
gtggctgctcaaaactgctataaggtgcccaaaggagccttcaccggggagatcagccca
gcgatgattaaagactgcggcatcgactgggtgattttgggccattctgagaggcgtcat
gtttttggggagagcgatgagctgattggtcagaaggtggcccattgcctggagagcgat
ttgggcgtgatcgcctgcattggggagaaactggaggagagagaggctggaaccaccgag
gacgtggtgtttgagcagaccaaagtcatcgcagacaatgtgaaggactggactcgtgtg
gtcttggcgtatgaaccagtatgggctattggcactggcaaaactgcctctcctgaacag
gcgcaggaggtgcacgagaagctgagagaatggctgagagcgaacgtgtcggatgcagtt
gctgactctgtgcgcatcatctacggaggctctgttactgggggaaactgcaaagagctg
gcggcccaggctgacgttgatggcttcctggttggaggggcttcccttaaaccagagttt
gtcgacatcatcaatgcccgctcgtag

DBGET integrated database retrieval system