KEGG   Danio rerio (zebrafish): 192309Help
Entry
192309            CDS       T01004                                 

Gene name
tpi1a, DrTPI-A
Definition
triosephosphate isomerase 1a (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    192309 (tpi1a)
   01230 Biosynthesis of amino acids
    192309 (tpi1a)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    192309 (tpi1a)
   00051 Fructose and mannose metabolism
    192309 (tpi1a)
   00562 Inositol phosphate metabolism
    192309 (tpi1a)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     192309 (tpi1a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   192309 (tpi1a)
  Exosomal proteins of bladder cancer cells
   192309 (tpi1a)
  Exosomal proteins of melanoma cells
   192309 (tpi1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 248 aa AA seqDB search
MSSRKFFVGGNWKMNGDKESLGELIMTLNTASLNDKTDVVCGAPSIYLDYARSKLDQRIG
VAAQNCYKVPKGAFTGEISPAMIKDCGIDWVILGHSERRHVFGESDELIGQKVAHCLESD
LGVIACIGEKLEEREAGTTEDVVFEQTKVIADNVKDWTRVVLAYEPVWAIGTGKTASPEQ
AQEVHEKLREWLRANVSDAVADSVRIIYGGSVTGGNCKELAAQADVDGFLVGGASLKPEF
VDIINARS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaggaaattcttcgtcggaggaaactggaaaatgaacggcgataaagagtct
ctgggcgagctcataatgaccttgaacacggccagtctcaacgataaaacagatgtagtt
tgtggagcaccgtccatctatttggattacgccaggtctaaactggaccagaggattggt
gtggctgctcaaaactgctataaggtgcccaaaggagccttcaccggggagatcagccca
gcgatgattaaagactgcggcatcgactgggtgattttgggccattctgagaggcgtcat
gtttttggggagagcgatgagctgattggtcagaaggtggcccattgcctggagagcgat
ttgggcgtgatcgcctgcattggggagaaactggaggagagagaggctggaaccaccgag
gacgtggtgtttgagcagaccaaagtcatcgcagacaatgtgaaggactggactcgtgtg
gtcttggcgtatgaaccagtatgggctattggcactggcaaaactgcctctcctgaacag
gcgcaggaggtgcacgagaagctgagagaatggctgagagcgaacgtgtcggatgcagtt
gctgactctgtgcgcatcatctacggaggctctgttactgggggaaactgcaaagagctg
gcggcccaggctgacgttgatggcttcctggttggaggggcttcccttaaaccagagttt
gtcgacatcatcaatgcccgctcgtag

DBGET integrated database retrieval system