KEGG   Danio rerio (zebrafish): 245701Help
Entry
245701            CDS       T01004                                 

Gene name
igf1ra, IGF-IRa, wu:fi20b10
Definition
insulin-like growth factor 1a receptor (EC:2.7.10.1)
Orthology
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Oocyte meiosis
Endocytosis
Focal adhesion
Adherens junction
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    245701 (igf1ra)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    245701 (igf1ra)
  Cell growth and death
   04114 Oocyte meiosis
    245701 (igf1ra)
  Cell communication
   04510 Focal adhesion
    245701 (igf1ra)
   04520 Adherens junction
    245701 (igf1ra)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    245701 (igf1ra)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     245701 (igf1ra)
Protein kinases [BR:dre01001]
 Tyrosine protein kinases
  InsR family [OT]
   245701 (igf1ra)
Enzyme-linked receptors [BR:dre01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   245701 (igf1ra)
Cytokine receptors [BR:dre04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   245701 (igf1ra)
Cellular antigens [BR:dre04090]
 Proteins
  245701 (igf1ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1405 aa AA seqDB search
MRSGTARDVWTLFWGPALFLSTICLRCARGEVCGPHIDIRNDITEFKKLENCTVVEGYLQ
ILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNYIAGNKQ
TKECGDVCPGINKDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEKRACTDAGQCCHPQ
CLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVDFV
IHNGECMPDCPPGFTRNETLSMFCSACDGLCDKVCESKTIDSVDAAQSLQGCTVIKGNLQ
INIRRGNNIASELESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNTYAFH
AVDNHNLQYLWDWTQHNLTIRTGKLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDVRSNG
ERASCESYILKFRSNHTQSTRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDG
CGSNSWNMVDVDLPQEKSIDPGVLLSPLKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYI
RTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYVLRWQQQAEDGELYQHNYCS
KELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEAEDRSYRKVFEN
FLHNSIFTPRPPDRKRRDLMGVANSTLVSGVSRNISVLESNITQPELPEKEYPFSEGKVH
TEFMEIHNLRPFTVYRIDIHACNYEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKG
EGIVLLRWPEPLHPNGLILMYEIKYRLGTEAEKHECVSRQQYKVLRGAQLSNLASGNYSA
RVRATSLAGNGSWTEPVSFYVPPPKRNYDNALYVAIIIPVIVLLLLLFVIVAVIIVTKKR
NSDRIGNGVLYASVNPEYFSPFEMYVPDEWEVAREKITMCRELGQGSFGMVYEGIAKGVV
KDEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELM
TRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVL
WEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
INSIKEELEPPFREVSFFYSEENKPPDTEELDMEVENMENVPLDPRSTLAPSSQGNTGIQ
SQNPQPLSPAQGPGTPLGSAQTPSTSPPSSSASPGLALDKHSGQVAANGPVVLLGPAFDE
TQPYAHMNGGRKNERALPLPQSSAC
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagatctggaacagcgagggatgtttggaccttattttggggtcctgcgctgtttctc
tccaccatctgcctgcggtgtgcccgtggagaagtctgtggtcctcatattgatatccgc
aatgacatcactgagttcaagaagctggaaaactgcacggtggtggaaggatacctgcag
attctccttattggagacaagaacaacaacctcaaccaggaacactttcgcacactgtcc
ttccccaagttgaccatggtaacggactacattctcctgttccgtgtctccggtctggac
agcctgagtgtgctcttccctaacctcaacgtcatccgaggacgcaatctattctacaac
tacgccctggtcatcttcgaaatgaccagcctgaaagatatcggtctgtataacctgagg
aacatcaccagaggggccatccgaatcgaaaagaacccagagctgtgctacttggattcg
gttgactggtcactccttatggatgcagagtttaacaactacatcgctggcaacaagcag
accaaagaatgcggagatgtttgtccaggcatcaataaggatagaccgcattgcataagg
accagtttcaatgacaactacagttatcgctgctggacctctaaccactgccagaaagtg
tgtcctaaggagtgtgagaagagagcgtgcacggatgcgggccagtgttgtcacccccag
tgcctgggcagctgtacggaagcagacaatgataaagcatgcgccgcctgccagcattat
tttcacgaggaccgatgtgttgaggcctgcccgccagatacctacaagtttgaaggatgg
cgctgcatcacaatggagatgtgtgcccgtgttcacctacccagcgaggtggacttcgtc
attcacaacggagagtgtatgccggactgtccacccggattcacccgaaatgagactctg
agtatgttttgcagcgcgtgtgacggcctgtgcgataaagtctgcgaatctaaaacaatc
gactctgtggacgcggctcaatcactgcagggctgcacagtcatcaaaggcaacctgcaa
atcaacatccgccggggcaataacattgcatcagagctggagagtttcatggggctgatc
cagacagtgactggatatgtaaggatcaagcacactcatactctgggctctctgtccttc
ctcaagagcctgcgatacattgttggagaagagcttgtggataatacatacgcattccat
gcagtggacaatcacaacttgcagtatctctgggactggactcagcacaatctgaccatt
agaacggggaaactatacttccgcttcaatcccaagctttgcatgtctgagatccggaaa
atgtgggagaaaaccagcgtcagggaaaagatggcagaggacgatgttcgtagcaacgga
gagcgagcaagttgtgagagttatattcttaagttcagatccaaccacactcagagtact
cggataaagctcacttgggagcgatatcgaccgccagactacagagacctcatcagcttc
attgtgtattacaaggaggcaccattccagaacatcactgaattcgatggacaggatggg
tgtggctctaatagctggaacatggtggatgtggaccttcctcaggaaaaatcgatagat
cctggagtactgctgtccccccttaaaccctggactcagtatgccatctttgtgaaggcc
gtcactctggttgtagaggacaagcatgttgggggagctaagagtgaggtggtctacatc
cgcaccaatgcatcagcgccgtcaatgccccttgatgcccgtgcatatgccaactcctct
tcatccctgatggtgaagtggtctcctcctatcgctcccaacggaaacaaaacattctac
gtgctccgttggcagcagcaggcagaagatggtgaactctaccagcataactactgctct
aaagagcttaagatcccaatccggatctcggccacatctttgtcagacatggagggcgaa
acaaagcccacaaaatcagatgttgccgggggtgagaagggttgctgcccctgcccaaaa
accaaggaggacctgaaggcagaagctgaagaccgatcctaccgcaaagtctttgagaac
ttcctgcacaactctatattcacacccagacctccagacaggaagcgtcgagacttgatg
ggagtggccaacagcacactagtgtcgggtgtgagcaggaacatctcagttctggagagt
aacatcactcagccagagctgccagaaaaagagtacccgttctctgaaggcaaagtccac
acagagttcatggagatacacaaccttcggcccttcaccgtctaccgcattgacatccac
gcctgcaactatgaagtccaccggtgcagtgctgcggcctttgtgttctccagaaccaaa
ccggcagataaagcggatgatattcccggctctgtgactcaggagagggatgagaaggga
gaaggaatagtgcttctgcggtggcctgaacctcttcaccccaacggactgatcctcatg
tatgagatcaaatatcgtctgggaactgaggctgagaagcatgaatgtgtatcacgacag
cagtacaaagttctgcgaggagctcagcttagcaatttggcctctggaaattattcagct
cgagtcagagccacttctctggctggaaacgggtcttggactgaaccagtgtccttctac
gtgccaccccctaaacggaattatgataatgccttatacgtggccatcattatccctgtt
atagtgctacttttgctactcttcgtgatcgtagctgtcatcattgtgaccaaaaagagg
aatagtgacaggataggaaatggtgtgctgtatgcttctgtgaaccccgagtacttcagt
ccatttgaaatgtatgtgccagatgaatgggaagtggctcgagagaagatcaccatgtgc
cgtgagctgggccagggctcttttggtatggtgtatgagggcattgcaaagggtgtcgtt
aaagatgaacctgagaccagagtggctatcaagactgtaaacgaatccgccagcgtacgt
gaacgcatcgagttcctgaacgaagcttcagttatgaaggagttcaactgtcaccatgtg
gtgcgtcttctgggtgtggtttcacaaggacagcctactctagttataatggagctgatg
acgcggggtgatctgaaaagccacttgcgctcgctccgatccaaagagcagggctccagc
agccagtctttgcctccgctgaagaagatgattcagatggcgggtgagatagcggatggg
atggcgtacctcaatgccaacaagttcgtccatcgagatctggctgccagaaactgcatg
gttgctgaagactttacagttaaaatcggagactttggcatgacgagggacatctatgag
actgactactatcgcaaaggaggcaaagggctgctgccggtgcgctggatgtctccagag
tctttgaaagatggcgtcttcacaactaattctgatgtctggtcgtttggtgtggtttta
tgggagatcgccacattagccgaacagccctaccagggcatgtccaacgagcaggtactg
cgcttcgtcatggagggaggacttctggataaaccggacaactgccccgacatgctgttt
gagctaatgcgcatgtgctggcagtataaccctaagatgcggccatctttcctggagatc
atcaacagcataaaagaggaactggagcctcctttccgggaggttagctttttctacagt
gaggagaacaagccacccgatactgaggaactggacatggaggtggagaacatggagaac
gtcccgctggatcctcgatccacattggccccctcttctcaggggaacacaggaattcaa
tcccagaacccgcagccgctctccccagcgcaggggcctgggacgccgcttgggtctgca
cagaccccctccacctctccgccctcatcctcagcctctccaggcctggctctggataag
cactcaggacaggtagcggcaaatggaccggtggtgctgctggggccggcgtttgacgag
acgcagccttacgcacacatgaacggcgggaggaagaacgagcgagcgctgccactgcct
cagtcctcggcctgctga

DBGET integrated database retrieval system