KEGG   Danio rerio (zebrafish): 245701Help
Entry
245701            CDS       T01004                                 

Gene name
igf1ra
Definition
(RefSeq) insulin-like growth factor 1 receptor precursor
  KO
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Oocyte meiosis
Autophagy - animal
Endocytosis
mTOR signaling pathway
Focal adhesion
Adherens junction
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    245701 (igf1ra)
   04150 mTOR signaling pathway
    245701 (igf1ra)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    245701 (igf1ra)
   04140 Autophagy - animal
    245701 (igf1ra)
  Cell growth and death
   04114 Oocyte meiosis
    245701 (igf1ra)
  Cellular community - eukaryotes
   04510 Focal adhesion
    245701 (igf1ra)
   04520 Adherens junction
    245701 (igf1ra)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    245701 (igf1ra)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     245701 (igf1ra)
Protein kinases [BR:dre01001]
 Tyrosine protein kinases
  InsR family [OT]
   245701 (igf1ra)
Enzyme-linked receptors [BR:dre01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   245701 (igf1ra)
Cytokine receptors [BR:dre04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   245701 (igf1ra)
CD molecules [BR:dre04090]
 Proteins
  245701 (igf1ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1405 aa AA seqDB search
MRSGTARDVWTLFWGPALFLSTICLRCARGEVCGPHIDIRNDITEFKKLENCTVVEGYLQ
ILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNYIAGNKQ
TKECGDVCPGINKDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEKRACTDAGQCCHPQ
CLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVDFV
IHNGECMPDCPPGFTRNETLSMFCSACDGLCDKVCESKTIDSVDAAQSLQGCTVIKGNLQ
INIRRGNNIASELESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNTYAFH
AVDNHNLQYLWDWTQHNLTIRTGKLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDVRSNG
ERASCESYILKFRSNHTQSTRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDG
CGSNSWNMVDVDLPQEKSIDPGVLLSPLKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYI
RTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYVLRWQQQAEDGELYQHNYCS
KELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEAEDRSYRKVFEN
FLHNSIFTPRPPDRKRRDLMGVANSTLVSGVSRNISVLESNITQPELPEKEYPFSEGKVH
TEFMEIHNLRPFTVYRIDIHACNYEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKG
EGIVLLRWPEPLHPNGLILMYEIKYRLGTEAEKHECVSRQQYKVLRGAQLSNLASGNYSA
RVRATSLAGNGSWTEPVSFYVPPPKRNYDNALYVAIIIPVIVLLLLLFVIVAVIIVTKKR
NSDRIGNGVLYASVNPEYFSPFEMYVPDEWEVAREKITMCRELGQGSFGMVYEGIAKGVV
KDEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELM
TRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVL
WEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
INSIKEELEPPFREVSFFYSEENKPPDTEELDMEVENMENVPLDPRSTLAPSSQGNTGIQ
SQNPQPLSPAQGPGTPLGSAQTPSTSPPSSSASPGLALDKHSGQVAANGPVVLLGPAFDE
TQPYAHMNGGRKNERALPLPQSSAC
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagatctggaacagcgagggatgtttggaccttattttggggtcctgcgctgtttctc
tccaccatctgcctgcggtgtgcccgtggagaagtctgtggtcctcatattgatatccgc
aatgacatcactgagttcaagaagctggaaaactgcacggtggtggaaggatacctgcag
attctccttattggagacaagaacaacaacctcaaccaggaacactttcgcacactgtcc
ttccccaagttgaccatggtaacggactacattctcctgttccgtgtctccggtctggac
agcctgagtgtgctcttccctaacctcaacgtcatccgaggacgcaatctattctacaac
tacgccctggtcatcttcgaaatgaccagcctgaaagatatcggtctgtataacctgagg
aacatcaccagaggggccatccgaatcgaaaagaacccagagctgtgctacttggattcg
gttgactggtcactccttatggatgcagagtttaacaactacatcgctggcaacaagcag
accaaagaatgcggagatgtttgtccaggcatcaataaggatagaccgcattgcataagg
accagtttcaatgacaactacagttatcgctgctggacctctaaccactgccagaaagtg
tgtcctaaggagtgtgagaagagagcgtgcacggatgcgggccagtgttgtcacccccag
tgcctgggcagctgtacggaagcagacaatgataaagcatgcgccgcctgccagcattat
tttcacgaggaccgatgtgttgaggcctgcccgccagatacctacaagtttgaaggatgg
cgctgcatcacaatggagatgtgtgcccgtgttcacctacccagcgaggtggacttcgtc
attcacaacggagagtgtatgccggactgtccacccggattcacccgaaatgagactctg
agtatgttttgcagcgcgtgtgacggcctgtgcgataaagtctgcgaatctaaaacaatc
gactctgtggacgcggctcaatcactgcagggctgcacagtcatcaaaggcaacctgcaa
atcaacatccgccggggcaataacattgcatcagagctggagagtttcatggggctgatc
cagacagtgactggatatgtaaggatcaagcacactcatactctgggctctctgtccttc
ctcaagagcctgcgatacattgttggagaagagcttgtggataatacatacgcattccat
gcagtggacaatcacaacttgcagtatctctgggactggactcagcacaatctgaccatt
agaacggggaaactatacttccgcttcaatcccaagctttgcatgtctgagatccggaaa
atgtgggagaaaaccagcgtcagggaaaagatggcagaggacgatgttcgtagcaacgga
gagcgagcaagttgtgagagttatattcttaagttcagatccaaccacactcagagtact
cggataaagctcacttgggagcgatatcgaccgccagactacagagacctcatcagcttc
attgtgtattacaaggaggcaccattccagaacatcactgaattcgatggacaggatggg
tgtggctctaatagctggaacatggtggatgtggaccttcctcaggaaaaatcgatagat
cctggagtactgctgtccccccttaaaccctggactcagtatgccatctttgtgaaggcc
gtcactctggttgtagaggacaagcatgttgggggagctaagagtgaggtggtctacatc
cgcaccaatgcatcagcgccgtcaatgccccttgatgcccgtgcatatgccaactcctct
tcatccctgatggtgaagtggtctcctcctatcgctcccaacggaaacaaaacattctac
gtgctccgttggcagcagcaggcagaagatggtgaactctaccagcataactactgctct
aaagagcttaagatcccaatccggatctcggccacatctttgtcagacatggagggcgaa
acaaagcccacaaaatcagatgttgccgggggtgagaagggttgctgcccctgcccaaaa
accaaggaggacctgaaggcagaagctgaagaccgatcctaccgcaaagtctttgagaac
ttcctgcacaactctatattcacacccagacctccagacaggaagcgtcgagacttgatg
ggagtggccaacagcacactagtgtcgggtgtgagcaggaacatctcagttctggagagt
aacatcactcagccagagctgccagaaaaagagtacccgttctctgaaggcaaagtccac
acagagttcatggagatacacaaccttcggcccttcaccgtctaccgcattgacatccac
gcctgcaactatgaagtccaccggtgcagtgctgcggcctttgtgttctccagaaccaaa
ccggcagataaagcggatgatattcccggctctgtgactcaggagagggatgagaaggga
gaaggaatagtgcttctgcggtggcctgaacctcttcaccccaacggactgatcctcatg
tatgagatcaaatatcgtctgggaactgaggctgagaagcatgaatgtgtatcacgacag
cagtacaaagttctgcgaggagctcagcttagcaatttggcctctggaaattattcagct
cgagtcagagccacttctctggctggaaacgggtcttggactgaaccagtgtccttctac
gtgccaccccctaaacggaattatgataatgccttatacgtggccatcattatccctgtt
atagtgctacttttgctactcttcgtgatcgtagctgtcatcattgtgaccaaaaagagg
aatagtgacaggataggaaatggtgtgctgtatgcttctgtgaaccccgagtacttcagt
ccatttgaaatgtatgtgccagatgaatgggaagtggctcgagagaagatcaccatgtgc
cgtgagctgggccagggctcttttggtatggtgtatgagggcattgcaaagggtgtcgtt
aaagatgaacctgagaccagagtggctatcaagactgtaaacgaatccgccagcgtacgt
gaacgcatcgagttcctgaacgaagcttcagttatgaaggagttcaactgtcaccatgtg
gtgcgtcttctgggtgtggtttcacaaggacagcctactctagttataatggagctgatg
acgcggggtgatctgaaaagccacttgcgctcgctccgatccaaagagcagggctccagc
agccagtctttgcctccgctgaagaagatgattcagatggcgggtgagatagcggatggg
atggcgtacctcaatgccaacaagttcgtccatcgagatctggctgccagaaactgcatg
gttgctgaagactttacagttaaaatcggagactttggcatgacgagggacatctatgag
actgactactatcgcaaaggaggcaaagggctgctgccggtgcgctggatgtctccagag
tctttgaaagatggcgtcttcacaactaattctgatgtctggtcgtttggtgtggtttta
tgggagatcgccacattagccgaacagccctaccagggcatgtccaacgagcaggtactg
cgcttcgtcatggagggaggacttctggataaaccggacaactgccccgacatgctgttt
gagctaatgcgcatgtgctggcagtataaccctaagatgcggccatctttcctggagatc
atcaacagcataaaagaggaactggagcctcctttccgggaggttagctttttctacagt
gaggagaacaagccacccgatactgaggaactggacatggaggtggagaacatggagaac
gtcccgctggatcctcgatccacattggccccctcttctcaggggaacacaggaattcaa
tcccagaacccgcagccgctctccccagcgcaggggcctgggacgccgcttgggtctgca
cagaccccctccacctctccgccctcatcctcagcctctccaggcctggctctggataag
cactcaggacaggtagcggcaaatggaccggtggtgctgctggggccggcgtttgacgag
acgcagccttacgcacacatgaacggcgggaggaagaacgagcgagcgctgccactgcct
cagtcctcggcctgctga

DBGET integrated database retrieval system