KEGG   Danio rerio (zebrafish): 245701Help
Entry
245701            CDS       T01004                                 

Gene name
igf1ra, IGF-IRa, wu:fi20b10
Definition
insulin-like growth factor 1a receptor (EC:2.7.10.1)
Orthology
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Oocyte meiosis
Endocytosis
Focal adhesion
Adherens junction
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1405 aa AA seqDB search
MRSGTARDVWTLFWGPALFLSTICLRCARGEVCGPHIDIRNDITEFKKLENCTVVEGYLQ
ILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNYIAGNKQ
TKECGDVCPGINKDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEKRACTDAGQCCHPQ
CLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVDFV
IHNGECMPDCPPGFTRNETLSMFCSACDGLCDKVCESKTIDSVDAAQSLQGCTVIKGNLQ
INIRRGNNIASELESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNTYAFH
AVDNHNLQYLWDWTQHNLTIRTGKLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDVRSNG
ERASCESYILKFRSNHTQSTRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDG
CGSNSWNMVDVDLPQEKSIDPGVLLSPLKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYI
RTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYVLRWQQQAEDGELYQHNYCS
KELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEAEDRSYRKVFEN
FLHNSIFTPRPPDRKRRDLMGVANSTLVSGVSRNISVLESNITQPELPEKEYPFSEGKVH
TEFMEIHNLRPFTVYRIDIHACNYEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKG
EGIVLLRWPEPLHPNGLILMYEIKYRLGTEAEKHECVSRQQYKVLRGAQLSNLASGNYSA
RVRATSLAGNGSWTEPVSFYVPPPKRNYDNALYVAIIIPVIVLLLLLFVIVAVIIVTKKR
NSDRIGNGVLYASVNPEYFSPFEMYVPDEWEVAREKITMCRELGQGSFGMVYEGIAKGVV
KDEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELM
TRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVL
WEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
INSIKEELEPPFREVSFFYSEENKPPDTEELDMEVENMENVPLDPRSTLAPSSQGNTGIQ
SQNPQPLSPAQGPGTPLGSAQTPSTSPPSSSASPGLALDKHSGQVAANGPVVLLGPAFDE
TQPYAHMNGGRKNERALPLPQSSAC
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagatctggaacagcgagggatgtttggaccttattttggggtcctgcgctgtttctc
tccaccatctgcctgcggtgtgcccgtggagaagtctgtggtcctcatattgatatccgc
aatgacatcactgagttcaagaagctggaaaactgcacggtggtggaaggatacctgcag
attctccttattggagacaagaacaacaacctcaaccaggaacactttcgcacactgtcc
ttccccaagttgaccatggtaacggactacattctcctgttccgtgtctccggtctggac
agcctgagtgtgctcttccctaacctcaacgtcatccgaggacgcaatctattctacaac
tacgccctggtcatcttcgaaatgaccagcctgaaagatatcggtctgtataacctgagg
aacatcaccagaggggccatccgaatcgaaaagaacccagagctgtgctacttggattcg
gttgactggtcactccttatggatgcagagtttaacaactacatcgctggcaacaagcag
accaaagaatgcggagatgtttgtccaggcatcaataaggatagaccgcattgcataagg
accagtttcaatgacaactacagttatcgctgctggacctctaaccactgccagaaagtg
tgtcctaaggagtgtgagaagagagcgtgcacggatgcgggccagtgttgtcacccccag
tgcctgggcagctgtacggaagcagacaatgataaagcatgcgccgcctgccagcattat
tttcacgaggaccgatgtgttgaggcctgcccgccagatacctacaagtttgaaggatgg
cgctgcatcacaatggagatgtgtgcccgtgttcacctacccagcgaggtggacttcgtc
attcacaacggagagtgtatgccggactgtccacccggattcacccgaaatgagactctg
agtatgttttgcagcgcgtgtgacggcctgtgcgataaagtctgcgaatctaaaacaatc
gactctgtggacgcggctcaatcactgcagggctgcacagtcatcaaaggcaacctgcaa
atcaacatccgccggggcaataacattgcatcagagctggagagtttcatggggctgatc
cagacagtgactggatatgtaaggatcaagcacactcatactctgggctctctgtccttc
ctcaagagcctgcgatacattgttggagaagagcttgtggataatacatacgcattccat
gcagtggacaatcacaacttgcagtatctctgggactggactcagcacaatctgaccatt
agaacggggaaactatacttccgcttcaatcccaagctttgcatgtctgagatccggaaa
atgtgggagaaaaccagcgtcagggaaaagatggcagaggacgatgttcgtagcaacgga
gagcgagcaagttgtgagagttatattcttaagttcagatccaaccacactcagagtact
cggataaagctcacttgggagcgatatcgaccgccagactacagagacctcatcagcttc
attgtgtattacaaggaggcaccattccagaacatcactgaattcgatggacaggatggg
tgtggctctaatagctggaacatggtggatgtggaccttcctcaggaaaaatcgatagat
cctggagtactgctgtccccccttaaaccctggactcagtatgccatctttgtgaaggcc
gtcactctggttgtagaggacaagcatgttgggggagctaagagtgaggtggtctacatc
cgcaccaatgcatcagcgccgtcaatgccccttgatgcccgtgcatatgccaactcctct
tcatccctgatggtgaagtggtctcctcctatcgctcccaacggaaacaaaacattctac
gtgctccgttggcagcagcaggcagaagatggtgaactctaccagcataactactgctct
aaagagcttaagatcccaatccggatctcggccacatctttgtcagacatggagggcgaa
acaaagcccacaaaatcagatgttgccgggggtgagaagggttgctgcccctgcccaaaa
accaaggaggacctgaaggcagaagctgaagaccgatcctaccgcaaagtctttgagaac
ttcctgcacaactctatattcacacccagacctccagacaggaagcgtcgagacttgatg
ggagtggccaacagcacactagtgtcgggtgtgagcaggaacatctcagttctggagagt
aacatcactcagccagagctgccagaaaaagagtacccgttctctgaaggcaaagtccac
acagagttcatggagatacacaaccttcggcccttcaccgtctaccgcattgacatccac
gcctgcaactatgaagtccaccggtgcagtgctgcggcctttgtgttctccagaaccaaa
ccggcagataaagcggatgatattcccggctctgtgactcaggagagggatgagaaggga
gaaggaatagtgcttctgcggtggcctgaacctcttcaccccaacggactgatcctcatg
tatgagatcaaatatcgtctgggaactgaggctgagaagcatgaatgtgtatcacgacag
cagtacaaagttctgcgaggagctcagcttagcaatttggcctctggaaattattcagct
cgagtcagagccacttctctggctggaaacgggtcttggactgaaccagtgtccttctac
gtgccaccccctaaacggaattatgataatgccttatacgtggccatcattatccctgtt
atagtgctacttttgctactcttcgtgatcgtagctgtcatcattgtgaccaaaaagagg
aatagtgacaggataggaaatggtgtgctgtatgcttctgtgaaccccgagtacttcagt
ccatttgaaatgtatgtgccagatgaatgggaagtggctcgagagaagatcaccatgtgc
cgtgagctgggccagggctcttttggtatggtgtatgagggcattgcaaagggtgtcgtt
aaagatgaacctgagaccagagtggctatcaagactgtaaacgaatccgccagcgtacgt
gaacgcatcgagttcctgaacgaagcttcagttatgaaggagttcaactgtcaccatgtg
gtgcgtcttctgggtgtggtttcacaaggacagcctactctagttataatggagctgatg
acgcggggtgatctgaaaagccacttgcgctcgctccgatccaaagagcagggctccagc
agccagtctttgcctccgctgaagaagatgattcagatggcgggtgagatagcggatggg
atggcgtacctcaatgccaacaagttcgtccatcgagatctggctgccagaaactgcatg
gttgctgaagactttacagttaaaatcggagactttggcatgacgagggacatctatgag
actgactactatcgcaaaggaggcaaagggctgctgccggtgcgctggatgtctccagag
tctttgaaagatggcgtcttcacaactaattctgatgtctggtcgtttggtgtggtttta
tgggagatcgccacattagccgaacagccctaccagggcatgtccaacgagcaggtactg
cgcttcgtcatggagggaggacttctggataaaccggacaactgccccgacatgctgttt
gagctaatgcgcatgtgctggcagtataaccctaagatgcggccatctttcctggagatc
atcaacagcataaaagaggaactggagcctcctttccgggaggttagctttttctacagt
gaggagaacaagccacccgatactgaggaactggacatggaggtggagaacatggagaac
gtcccgctggatcctcgatccacattggccccctcttctcaggggaacacaggaattcaa
tcccagaacccgcagccgctctccccagcgcaggggcctgggacgccgcttgggtctgca
cagaccccctccacctctccgccctcatcctcagcctctccaggcctggctctggataag
cactcaggacaggtagcggcaaatggaccggtggtgctgctggggccggcgtttgacgag
acgcagccttacgcacacatgaacggcgggaggaagaacgagcgagcgctgccactgcct
cagtcctcggcctgctga

DBGET integrated database retrieval system