KEGG   Danio rerio (zebrafish): 246092Help
Entry
246092            CDS       T01004                                 

Gene name
cpa5, cb1060, cpa, wu:fb68f03
Definition
carboxypeptidase A5
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     246092 (cpa5)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   246092 (cpa5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 419 aa AA seqDB search
MKRLLVLIALFVAVFGKKTFEGDQVFRITPKDEAQIDLLKELTEEGEHLGLSVWMEPILE
SLPLDLHVPFHSLQAVRAFLAYNQIPYHIMIENVQELLDDEQRDMVKYRGLARSTDDFVY
TTYHDLNSINSFMDMLVAENRNMVSKVVIGQSYEKRPLNVLKFSTGANRPGIWIDTGIHS
REWVTQASGVWFAKKIVKDYGRDPVLTDILNSHDIFLEIVTNPDGFVYTHTKDRMWRKTR
KPNPGSSCVGVDPNRNWDAGFGGGGSSNNPCTETYRGPSAHSEPEVKAIVDFVKSHGKIK
AFVSIHSYSQMLLYPYGYTYTAAKDKAELHEVARKAITSLQSLYNTRYTYGSIITTIYQA
SGGTIDWTYNQGIKYSYTFELRDTGRYGFILPANQIVPTAEETWLALMAIMEHTKNNPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctgctggtgctgatcgctctgtttgtggccgtctttggcaaaaagaccttt
gagggggatcaggtgtttcggatcactccaaaagatgaagctcagattgacctcctgaag
gagctcactgaagagggcgaacatcttggccttagtgtctggatggagcccattcttgag
tctctgcctctggatcttcatgtcccctttcacagtctccaggctgtcagggcgtttctg
gcctacaatcagatcccataccacatcatgatcgagaatgtccaggaactgttggatgat
gagcaacgtgatatggtgaaatatcgtggccttgcaagatctacagatgactttgtgtac
accacctaccatgacctgaactctatcaactcattcatggacatgcttgtcgcagagaac
aggaacatggtcagcaaagttgtgattggtcagagctacgagaaacgccccttgaatgtc
ctgaagttcagcactggagcaaaccgtcctggtatctggatcgacactggtatccactcc
agagaatgggtcacccaggctagtggagtctggtttgccaagaagatcgtgaaagactat
ggacgtgaccccgtcctcactgacatcttgaacagccatgatatcttcctggagattgtc
accaaccctgacggtttcgtctacacccacaccaaagaccgcatgtggcgtaaaaccaga
aagccaaaccctggctccagctgcgttggagttgatcccaacaggaactgggatgctggt
tttggaggtggtggttccagcaacaacccctgcactgaaacctaccgcggccccagtgct
cactctgagcccgaggtgaaggccattgtggactttgtgaagtctcacggcaaaatcaag
gcctttgtgtctatccacagctattcccagatgctcctctacccatacggatacacatat
accgccgccaaggacaaggctgaactgcatgaggtcgccaggaaggccatcacttcactg
cagtcattgtacaacactcgctacacctatggaagcatcattaccaccatctatcaagcc
agtggaggcactattgactggacctacaaccagggcatcaagtactcctacacctttgag
ctgagagacaccggtcgctatggttttattctgccagccaatcaaatcgtcccaaccgcc
gaggagacctggctcgctctgatggccatcatggagcacaccaagaataacccttattaa

DBGET integrated database retrieval system