KEGG   Danio rerio (zebrafish): 252849Help
Entry
252849            CDS       T01004                                 

Gene name
thbs3a, thbs3, tsp3, zgc:103461
Definition
thrombospondin 3a
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dre  Danio rerio (zebrafish)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dre04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:dre04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 962 aa AA seqDB search
MKQMFVHIWVSLVVLMFVWSAQSDKKQDVPVIDVLGLEDVKQTVAAVEKLSLALKTLSDV
YVMSTFRLPPKLGGVLLGLYNKQDNKKYLEVAIMSKINKVLVRYVREDGKLHTVNMQSPN
VADGRPQSLILRVGGLRREYLSLELYVNCRLADSAQRLPPLVDLPRDAELVEIRNGHKAY
ARMQGSMDTLKLALGGTVAQAGALTDCPFQGDASSYNIVNGEVNSILGDHTKALIGQLII
FNQILGELREDIREQVKEMSLVRNAILECQMCGFHEPRSRCQPNPCFKGVSCMETFEYPG
YRCGPCPDGMTGNGTHCQDIDECSEAQPCYTPGACVNTARGFTCESCPPGMWGPPLSGVG
VEYAKSHRQECSDIDECVDLANACTPNSVCINTIGSFRCGQCKTGYVGNQTAGCFPRKSC
SSLSFNPCDTNAHCVMQRNGDVSCACNVGWAGNGHTCGKDTDIDGYPDRSLPCMDNHKHC
RQDNCVYTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLVSNKDQQNSDTDSFGDA
CDNCPTVPNIDQKDTDSNGEGDACDDDIDGDGIQNVLDNCPKVPNPMQTDRDRDGVGDAC
DSCPEISNPMQTDVDNDLVGDVCDTNQDTDGDGHQDTRDNCPDIPNSSQLDSDNDGIGDD
CDEDDDNDGIPDNHAINGIGPDNCRLISNPNQKDSDSNGVGDVCENDFDNDSVMDLVDVC
PESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGV
DFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQSIPFRAMAEPGLQLKAV
KSRTGPGEFLRNALWHAGDTDGEVKLLWKDPRNVGWLDKTSYRWQLSHRPQVGYIRVKLY
EGSEMVADSDVVIDTSMRGGRLGVFCFSQENIIWSNLRYRCNDTVPEDFSSHRKQVLMHI
KV
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgtttgtacacatttgggtcagtctggtcgtgttgatgttcgtctggtca
gcacagagcgacaagaaacaagacgtgccagtgatagacgtgttgggtttggaggatgtg
aagcagaccgtggccgcggtggagaagctctcgttggctctgaaaactctcagtgacgtg
tatgtgatgtctacttttcgtcttcctccaaaacttggtggagttctgctggggctctac
aacaaacaggacaacaagaagtacctggaggttgccatcatgagcaagattaacaaagtt
ctggtcaggtatgtccgtgaggatggaaagctgcatacagtgaacatgcagagcccgaat
gttgcggatggacgtcctcagtcactgattctgcgtgtcgggggcctgcgccgggagtat
cttagcctcgagctctatgtgaactgtcgtctggctgactccgcccagcgcctgccccca
ttggtggatttgcccagagatgctgagctggtggagatacgaaatggacacaaggcatat
gctcggatgcagggttcaatggatactcttaaactggcactggggggcactgttgcccag
gctggcgctctcaccgactgtccctttcagggagacgcttcttcatacaacatagtgaat
ggtgaggttaattctattctaggtgaccacactaaagctctgatcggccagctgatcatc
tttaatcagatcttgggagagttgagagaggacatcagagaacaggtgaaagaaatgtcc
ctggtaaggaacgctattctggagtgccagatgtgtgggtttcacgagcctcgttcccgc
tgtcagccaaatccctgtttcaagggtgtgtcctgcatggagacgtttgaatacccaggg
taccgctgtgggccctgtccagacggcatgacgggcaacggtacacactgtcaggacatc
gatgagtgttcagaggctcagccgtgttatacaccgggtgcttgtgtcaatactgcaaga
ggttttacctgtgagtcatgtccccctggcatgtggggtccgcctttgtctggagtggga
gtggagtatgctaagagtcaccgtcaggagtgctctgacatcgatgaatgtgtagatttg
gccaacgcctgcacacccaactctgtctgcatcaacactattgggtcatttcgatgcggt
cagtgcaagactggatatgttggcaatcagacagccggatgtttccctcgaaaatcatgt
tcttcactcagtttcaacccctgtgacacgaacgctcactgcgtcatgcaacgcaacggg
gacgtgtcctgcgcttgtaatgttggatgggctggtaatggtcacacctgcgggaaggac
acagatattgatggttatcctgaccgctctctgccctgcatggacaatcacaagcactgc
agacaggacaactgtgtctacacacccaattctggtcaggaagatgcggataatgatgga
attggagatcagtgtgatgaagatgctgatggagacggaattaagaacgtagaggataac
tgtcgtttggtctccaataaagaccagcagaactcggacacagattcgttcggagacgcg
tgtgataactgtcccaccgttcccaacatcgaccagaaagacactgatagcaacggagag
ggagacgcttgtgatgacgacattgatggagatgggattcagaatgttctggataactgt
cctaaagtgccgaacccgatgcagacggaccgggacagagacggagtaggcgatgcatgt
gacagctgtcctgagatcagcaaccccatgcagacggatgtagacaatgacttagtcggg
gatgtttgtgacaccaaccaagacacagatggagacggacaccaggacactcgggataac
tgtcccgatatcccaaacagctctcagctggactcagataatgacggcatcggagacgac
tgtgatgaagacgacgacaacgatggcatcccggacaatcacgccatcaatggcataggg
cccgataactgcagactcatatccaaccccaaccagaaagactcagacagtaatggagtg
ggcgatgtatgcgagaatgacttcgacaatgattcagtgatggatttggttgacgtgtgt
ccagaaagtgctgaagtcacacttacagatttcagagcctatcaaacggtcattctggac
ccggaaggtgacgctcagattgaccccaactgggtggtgctcaatcagggaatggaaata
gttcagaccatgaacagtgaccctggactggcagtgggttatacagcgtttaacggcgtg
gactttgagggaacatttcacgtgaacacagtgaccgacgatgactatgccggcttcatc
ttcggctaccaggattcatctagtttctacgtggtgatgtggaagcagaccgaacagaca
tactggcagtccatcccattcagagccatggctgaaccgggcctgcagctcaaggcagtg
aagtctcgtactggtcctggtgagtttcttcgtaacgctctgtggcatgctggagatact
gatggagaggtgaagctgctgtggaaagacccacgaaacgtcggctggctggataaaaca
tcgtatcggtggcagctcagccatcggcctcaggtcggatacatcagggtgaagctgtat
gagggctcagagatggtggcagactcagatgtggtaatcgacacctctatgagaggaggt
cgtctgggcgtcttctgcttctctcaggagaacatcatttggtccaatctgcgctaccgc
tgcaacgataccgttccagaggacttcagttcacaccgtaagcaggttctgatgcacata
aaggtgtga

DBGET integrated database retrieval system