KEGG   Danio rerio (zebrafish): 252849Help
Entry
252849            CDS       T01004                                 

Gene name
thbs3a, thbs3, tsp3, zgc:103461
Definition
thrombospondin 3a
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dre  Danio rerio (zebrafish)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    252849 (thbs3a)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    252849 (thbs3a)
  Cell communication
   04510 Focal adhesion
    252849 (thbs3a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   252849 (thbs3a)
  Exosomal proteins of colorectal cancer cells
   252849 (thbs3a)
  Exosomal proteins of bladder cancer cells
   252849 (thbs3a)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  252849 (thbs3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 962 aa AA seqDB search
MKQMFVHIWVSLVVLMFVWSAQSDKKQDVPVIDVLGLEDVKQTVAAVEKLSLALKTLSDV
YVMSTFRLPPKLGGVLLGLYNKQDNKKYLEVAIMSKINKVLVRYVREDGKLHTVNMQSPN
VADGRPQSLILRVGGLRREYLSLELYVNCRLADSAQRLPPLVDLPRDAELVEIRNGHKAY
ARMQGSMDTLKLALGGTVAQAGALTDCPFQGDASSYNIVNGEVNSILGDHTKALIGQLII
FNQILGELREDIREQVKEMSLVRNAILECQMCGFHEPRSRCQPNPCFKGVSCMETFEYPG
YRCGPCPDGMTGNGTHCQDIDECSEAQPCYTPGACVNTARGFTCESCPPGMWGPPLSGVG
VEYAKSHRQECSDIDECVDLANACTPNSVCINTIGSFRCGQCKTGYVGNQTAGCFPRKSC
SSLSFNPCDTNAHCVMQRNGDVSCACNVGWAGNGHTCGKDTDIDGYPDRSLPCMDNHKHC
RQDNCVYTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLVSNKDQQNSDTDSFGDA
CDNCPTVPNIDQKDTDSNGEGDACDDDIDGDGIQNVLDNCPKVPNPMQTDRDRDGVGDAC
DSCPEISNPMQTDVDNDLVGDVCDTNQDTDGDGHQDTRDNCPDIPNSSQLDSDNDGIGDD
CDEDDDNDGIPDNHAINGIGPDNCRLISNPNQKDSDSNGVGDVCENDFDNDSVMDLVDVC
PESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGV
DFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQSIPFRAMAEPGLQLKAV
KSRTGPGEFLRNALWHAGDTDGEVKLLWKDPRNVGWLDKTSYRWQLSHRPQVGYIRVKLY
EGSEMVADSDVVIDTSMRGGRLGVFCFSQENIIWSNLRYRCNDTVPEDFSSHRKQVLMHI
KV
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgtttgtacacatttgggtcagtctggtcgtgttgatgttcgtctggtca
gcacagagcgacaagaaacaagacgtgccagtgatagacgtgttgggtttggaggatgtg
aagcagaccgtggccgcggtggagaagctctcgttggctctgaaaactctcagtgacgtg
tatgtgatgtctacttttcgtcttcctccaaaacttggtggagttctgctggggctctac
aacaaacaggacaacaagaagtacctggaggttgccatcatgagcaagattaacaaagtt
ctggtcaggtatgtccgtgaggatggaaagctgcatacagtgaacatgcagagcccgaat
gttgcggatggacgtcctcagtcactgattctgcgtgtcgggggcctgcgccgggagtat
cttagcctcgagctctatgtgaactgtcgtctggctgactccgcccagcgcctgccccca
ttggtggatttgcccagagatgctgagctggtggagatacgaaatggacacaaggcatat
gctcggatgcagggttcaatggatactcttaaactggcactggggggcactgttgcccag
gctggcgctctcaccgactgtccctttcagggagacgcttcttcatacaacatagtgaat
ggtgaggttaattctattctaggtgaccacactaaagctctgatcggccagctgatcatc
tttaatcagatcttgggagagttgagagaggacatcagagaacaggtgaaagaaatgtcc
ctggtaaggaacgctattctggagtgccagatgtgtgggtttcacgagcctcgttcccgc
tgtcagccaaatccctgtttcaagggtgtgtcctgcatggagacgtttgaatacccaggg
taccgctgtgggccctgtccagacggcatgacgggcaacggtacacactgtcaggacatc
gatgagtgttcagaggctcagccgtgttatacaccgggtgcttgtgtcaatactgcaaga
ggttttacctgtgagtcatgtccccctggcatgtggggtccgcctttgtctggagtggga
gtggagtatgctaagagtcaccgtcaggagtgctctgacatcgatgaatgtgtagatttg
gccaacgcctgcacacccaactctgtctgcatcaacactattgggtcatttcgatgcggt
cagtgcaagactggatatgttggcaatcagacagccggatgtttccctcgaaaatcatgt
tcttcactcagtttcaacccctgtgacacgaacgctcactgcgtcatgcaacgcaacggg
gacgtgtcctgcgcttgtaatgttggatgggctggtaatggtcacacctgcgggaaggac
acagatattgatggttatcctgaccgctctctgccctgcatggacaatcacaagcactgc
agacaggacaactgtgtctacacacccaattctggtcaggaagatgcggataatgatgga
attggagatcagtgtgatgaagatgctgatggagacggaattaagaacgtagaggataac
tgtcgtttggtctccaataaagaccagcagaactcggacacagattcgttcggagacgcg
tgtgataactgtcccaccgttcccaacatcgaccagaaagacactgatagcaacggagag
ggagacgcttgtgatgacgacattgatggagatgggattcagaatgttctggataactgt
cctaaagtgccgaacccgatgcagacggaccgggacagagacggagtaggcgatgcatgt
gacagctgtcctgagatcagcaaccccatgcagacggatgtagacaatgacttagtcggg
gatgtttgtgacaccaaccaagacacagatggagacggacaccaggacactcgggataac
tgtcccgatatcccaaacagctctcagctggactcagataatgacggcatcggagacgac
tgtgatgaagacgacgacaacgatggcatcccggacaatcacgccatcaatggcataggg
cccgataactgcagactcatatccaaccccaaccagaaagactcagacagtaatggagtg
ggcgatgtatgcgagaatgacttcgacaatgattcagtgatggatttggttgacgtgtgt
ccagaaagtgctgaagtcacacttacagatttcagagcctatcaaacggtcattctggac
ccggaaggtgacgctcagattgaccccaactgggtggtgctcaatcagggaatggaaata
gttcagaccatgaacagtgaccctggactggcagtgggttatacagcgtttaacggcgtg
gactttgagggaacatttcacgtgaacacagtgaccgacgatgactatgccggcttcatc
ttcggctaccaggattcatctagtttctacgtggtgatgtggaagcagaccgaacagaca
tactggcagtccatcccattcagagccatggctgaaccgggcctgcagctcaaggcagtg
aagtctcgtactggtcctggtgagtttcttcgtaacgctctgtggcatgctggagatact
gatggagaggtgaagctgctgtggaaagacccacgaaacgtcggctggctggataaaaca
tcgtatcggtggcagctcagccatcggcctcaggtcggatacatcagggtgaagctgtat
gagggctcagagatggtggcagactcagatgtggtaatcgacacctctatgagaggaggt
cgtctgggcgtcttctgcttctctcaggagaacatcatttggtccaatctgcgctaccgc
tgcaacgataccgttccagaggacttcagttcacaccgtaagcaggttctgatgcacata
aaggtgtga

DBGET integrated database retrieval system