KEGG   Danio rerio (zebrafish): 252850Help
Entry
252850            CDS       T01004                                 

Gene name
thbs4b, thbs4, tsp4, zgc:111910
Definition
thrombospondin 4b
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dre  Danio rerio (zebrafish)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    252850 (thbs4b)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    252850 (thbs4b)
  Cellular commiunity
   04510 Focal adhesion
    252850 (thbs4b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   252850 (thbs4b)
  Exosomal proteins of colorectal cancer cells
   252850 (thbs4b)
  Exosomal proteins of bladder cancer cells
   252850 (thbs4b)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  252850 (thbs4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 949 aa AA seqDB search
MAGTMHLLTAVSLILMLSSANAESTVYNLLTSPDCLPDLLHGGLAEQGVTELYILTTFRI
QPGTGNTIFSLYNPRDNSKYFEFSVFGKANKAILRYLRRDGRMSAVTFNKLNLADGEKHR
LLFHLKGLEVGHPGGFPHSQGALPVPGVELHLDCRLVETLRDLPAVFNGLNNHQAVELKT
MQGKAQEGLEELKLAYGDSVENVASLQDCHTQSDSVQALGLNTKQLTTQMLELTKVINEL
KDVLIQQVKETSFLRNTISECQACGLSGAEVVKPKCAPGVCFRDDMCIETAEGVECGPCP
DGYTGDGYSCDDVDECQFNPCFPGVRCVNMAPGFRCEACPLGFTGKPLEGVGVAYAQTHK
QVCDDIDECKGPDNGGCTANSICVNSVGSYQCGRCKTGFTGDQIRGCKPEKSCGNRLQNP
CDPNAQCTEERDGTITCQCGIGWAGNGYLCGKDTDIDGYPDERLRCRDPTCRKDNCVTVP
NSGQEDADGDGKGDACDPDADGDGILNEQDNCWLTPNINQQNSDKDSHGDACDNCVRVDN
PDQRDTDSDGLGDACDDDMDGDGLKNFLDNCQRVKNRDQLDRDGDGVGDACDSCPDIPNP
NQSDIDNDLVGDSCDTNQDSDGDGHQDSKDNCPMVINSSQLDTDKDGIGDECDDDDDNDG
IPDSLPPGPDNCRLVPNPEQIDDNNDGVGDICESDFDQDKVIDRIDNCPENAEITLTDFR
AYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVT
DDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRN
SLWHTGDTNDQVRLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRVRFYEGTELVADSGVT
IDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFSTQHGMDPL
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggccggcacaatgcatctcctcacggccgtttctctgatcttaatgctcagctcagca
aacgcagaatcaaccgtgtataacctcttaacgtcaccggactgtctaccggatctactg
catggtggtttggcagagcagggagtaacggagctctatattctcacaacgttccggatc
caacctggaaccggaaacaccatatttagcctgtacaatccacgagacaacagcaagtac
tttgaattctcggtgtttggaaaagcaaataaagctattttgcgatacctgcgcagagat
ggcaggatgagtgcggtcacctttaacaaactgaacctggctgacggcgagaagcatcgg
ctgctcttccatctgaaaggactggaggtgggacatcccggaggcttcccgcacagccag
ggagcgctacctgtgcctggggtggagctacacctggattgcagactggtggagacgctg
agagatttaccagctgtgtttaacggcctaaacaatcaccaggcggtggagctcaagact
atgcaggggaaagcacaagagggcttggaggagctcaaactggcatatggcgattcagtg
gaaaatgttgcatcgctgcaggactgccacactcagagtgactcagtacaggctttaggg
cttaacacgaaacagcttacaactcagatgctggagctaacaaaggtcattaatgagctg
aaagacgttcttattcagcaggtgaaggaaacatctttcctcagaaacaccatctctgag
tgccaggcctgcgggctgagtggagcggaggtggtgaaaccaaagtgcgcccctggagtg
tgtttccgtgatgatatgtgcatagaaacagctgaaggagtggagtgtggtccatgcccc
gatggatacactggagatggatacagctgtgacgatgttgatgagtgccagtttaacccc
tgttttcctggtgtgaggtgtgtgaacatggctccaggcttccgctgtgaggcctgtcct
cttggattcactggcaaaccactggagggtgttggcgtggcctatgcacaaacacacaag
caggtgtgtgatgatattgatgagtgtaaagggccagataatggaggatgcacagcgaac
tccatctgtgtgaattctgtgggatcatatcaatgcgggcgatgcaaaaccggattcacg
ggagaccagatcagaggttgtaagccagagaaaagctgcggaaaccgtctgcagaaccct
tgcgatcccaatgcacagtgcacagaggagagagacggcaccattacatgccagtgtggc
attggatgggctggaaatggttatctctgcgggaaagacactgacatcgatgggtaccct
gatgagaggctgcgctgccgagacccaacctgcagaaaggataactgtgttaccgttcca
aactcgggacaagaggacgcagatggcgatgggaagggtgacgcatgtgacccagatgca
gatggagatggaatattgaatgagcaggataactgctggttgacgccaaatataaatcag
cagaatagtgataaggacagccatggtgatgcttgtgacaactgtgtccgagtggataac
ccagaccagagagacacagactctgatggactcggagatgcatgtgatgatgatatggat
ggagatgggctgaagaacttcctggataactgccagcgagtgaaaaatcgtgatcagctg
gatcgtgatggggatggggtgggggatgcatgcgatagctgtcctgatatcccaaatcca
aatcagtctgacattgacaatgatcttgtcggagactcttgtgatacaaatcaagacagt
gatggtgatggacaccaagatagcaaggacaactgcccgatggtaattaacagctcccag
ctagacacagataaagacggaataggagatgaatgtgatgatgacgatgataacgacggt
attcccgactcattgcctccaggaccagataactgtcggttggtgcccaaccctgaacag
atagacgacaacaatgatggagtgggtgacatatgtgaatccgactttgaccaggacaag
gtaatcgacaggatcgataactgtccagaaaatgccgagatcacactgacagatttcaga
gcctatcagacagttgtactggatccggagggtgatgcccagattgaccccaactgggtg
gttctcaaccagggaatggagattgtccaaacgatgaacagtgatccaggccttgctgtt
ggttacacggcatttagcggtgttgatttcgagggaacattccatgtaaatacagtgact
gatgacgactatgccgggttcatctttggataccaagattcctccagtttctatgtggtg
atgtggaagcaaacagaacagacgtactggcaggccacacccttcagagctgtagctgaa
cctggcattcagctgaaggcagtgaagtccaagactggtccaggtgagcatttgaggaac
tcgctctggcatacaggtgacactaatgatcaggtacgtctcctgtggaaggatccaaga
aacgttggttggaaggacaaggtatcataccgctggtacttgcagcaccgcccacaagtt
ggatacatcagggttcgtttctatgagggaacagagcttgttgcagattctggggtgaca
attgataccacaatgagaggaggaagactgggagtgttctgcttttctcaggagaacatc
atctggtcaaacttgaagtaccgctgcaatgacaccatcccagaggacttccaagagttc
agtacacaacatggcatggaccccttgtaa

DBGET integrated database retrieval system