KEGG   Danio rerio (zebrafish): 259196Help
Entry
259196            CDS       T01004                                 

Gene name
malt2, malt1, malt1a, pcasp2
Definition
(RefSeq) MALT paracaspase 2
  KO
K07369  
mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     259196 (malt2)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C14: caspase family
   259196 (malt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 806 aa AA seqDB search
MEDKNLGLENISEAALSRLGYMLDNAECGWKQLAKAVAEQPQFCYSDREMTDCSLKVLSP
HGSPGRYLLALLADRGCTLAFLLQCLKKIEHREAVGFLTMNVMEQIDIIQQPQSQRIAEG
SPVVLSCKAVGPVELQYQWFKGKDEMPEGNSPDLVFNRASPAQQGYYICRVSSGDKYIFS
NWAHVYLLRSGGASADSSSSYFPSTASGLNITQQPRPQALMEGDTLCLECSAQANPPPQF
QWYFNKELMPKCIRNFLKIPCITTADRGIYACRVYNLYHEMWSDQVQVNIGPGSCSESSW
EKTAVDNPEANLKQMGDCCATDKVALLIGNMNYLHHRQLRAPMADVHELTNLLRQLDFKV
VSLLDLNWQEMHSAVTEFLLLLDRGVYGLLYFAGHGYENYGNSFMVPIDAPASYTFKHCL
WVQEVLQRMQERQTGLNVFLLDMCRKRNPNDEGIPQPDPLRVTANIVFGYATCVDAEAFE
VNKDDLSNGIFMSFLKKRLMEPEKVTVILDKVAEDMGRCEITRGRQALELRSNLSERRAL
TDKIQAPACQIAASTRNLQWAIAHVLPESRCLQFECGVTVQLGFAAEFSNIMIIYTQILE
TPTDIVSCSAQLSDFTEGPEVDLKRSNQESLHEAESFLLTIDDLLPLKQPQLFTRISALQ
RLKKELSFTVCLHYKYGNLDEELLEEKRITVGKPLVSKLNLHEPRLFHSSSSDQQMSSFL
DSSSFSESFRANLPDLKQNFIGSASTSLPNYRVPMESFACFGLKNEPEETLCPEFLESEE
PPAIKSLPSASSEELPFKFSNFQNSI
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaagaatttggggttagaaaacataagtgaggcagcacttagtagacttggt
tacatgctagacaatgcagagtgtggctggaaacagctggcaaaggcagtggctgagcag
ccacagttctgctatagtgacagagagatgaccgactgctcactcaaagtgctaagtcca
catggcagtcctggcagatacctgcttgccctccttgcggatagaggctgtacgttggct
ttcctgcttcagtgcctgaagaaaatcgagcaccgagaggctgttggatttctcactatg
aatgtcatggagcagattgacatcatacagcagccacagagtcagcggatagcagagggg
agtcctgtggttctgagctgcaaagcagtcggtcctgtagagctccaataccagtggttc
aagggcaaagatgagatgccagaaggtaacagcccagatttggtgtttaatcgtgcaagt
ccagcacaacaggggtactacatctgtcgtgtaagttctggagacaagtacatcttctcc
aactgggctcatgtatatctgctgaggtctggaggtgcgagtgcagattccagcagcagc
tacttcccttcaacagctagtgggttgaatataacacaacaacccaggcctcaagcgtta
atggagggagacacgctctgtcttgaatgttctgcccaggccaacccgcctccacagttc
cagtggtattttaacaaagaacttatgccaaagtgcataagaaacttcttaaagattcca
tgcataacaacagctgacagaggtatttatgcctgcagagtttacaacctttatcacgaa
atgtggagtgatcaggtccaagtaaacattggtcctggttcctgttcggaaagctcatgg
gaaaaaactgcagtagataatcctgaggcgaatctaaagcaaatgggtgattgttgcgcc
actgataaggtagcactacttattgggaacatgaattacctgcatcatcggcagctgaga
gctcctatggcggatgttcacgagctgactaaccttctacgccagctagattttaaagtg
gtttctctgctggatctcaactggcaggagatgcatagcgctgttactgagttcctgctg
ctgttggatcgaggagtttatggcctgttgtattttgctggtcatggttatgagaactat
gggaacagttttatggtacccattgatgctccagcctcctacaccttcaagcattgtctg
tgggtgcaggaagtgttacagcggatgcaagaacgccagacaggacttaacgtctttctg
ctggacatgtgtcgaaaacgaaacccaaacgatgagggcatcccacaaccggaccccttg
agagtgacagcaaacatagtgtttggctatgctacgtgtgttgatgctgaagcatttgaa
gtaaataaagacgatctctctaatggaatcttcatgagcttcctgaagaaaagactaatg
gagccagagaaggtcacggtcatacttgacaaagtagcagaagacatgggaaggtgtgaa
atcactcgtggtcggcaggctctggagctccgtagtaatctatcagagcggcgtgctttg
acagacaaaattcaggctccagcatgccaaatcgcagcatcaacacggaatttacagtgg
gccattgcacatgtcctcccagagagccgctgtcttcagtttgaatgtggtgtcacggtg
cagctcggttttgctgcagagttttccaatatcatgataatctacactcagatattggag
actccaacagacattgtgtcctgctctgctcagctttctgattttactgagggccctgaa
gttgacctgaagcgcagcaatcaggagagtctccacgaggctgaaagcttcctgctgacc
atagatgatctactgcctctgaaacaacctcagctcttcactcgtattagtgccctgcag
agactcaagaaagaactctcctttactgtgtgtctacactacaagtatggtaatctggat
gaagagctcctggaagagaaaaggatcactgtgggaaaacctctagtgtccaaactcaat
ctccacgagccacggctctttcacagttcctcctctgatcaacaaatgtccagttttttg
gactcttcatccttcagcgaaagcttcagagctaacctgcctgacctaaaacaaaatttc
attggttctgcatctacatccttgcccaactatcgggtaccaatggaatcatttgcatgc
tttggtttgaagaacgaaccggaggaaacattatgtccagagtttcttgagtctgaagaa
cctcccgccattaagagtttacccagtgcttcttctgaggaactgccatttaaatttagc
aactttcaaaattccatttag

DBGET integrated database retrieval system