KEGG   Danio rerio (zebrafish): 266749Help
Entry
266749            CDS       T01004                                 

Gene name
pak2a, cb422, kinase, pak2, si:dz198m22.1, wu:fb71h01, zgc:91798
Definition
p21 (CDKN1A)-activated kinase 2a (EC:2.7.1.-)
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 517 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSA
EKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLKFYDSTGNSRQKYLSFTDKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRP
QHTISVYTRSVIDPIPAPAAIADTDGSKAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKK
KYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIV
NFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHR
DIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEK
RGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagagctggaggacaaaccccctgcccccccagtcagaatgagcagc
accttcagcaccggtattaaagacagtatgtcaacaaaccccagctctaaacccctgccc
tccgtcccagaggagaagagggacaaaccgcgcaacaagatcatatcaatattctcagct
gagaaaggaagaaaaaaagacaaggataaggagcgtccggagatttctaacccttcagat
ttcgagcacactatacatgtgggctttgattctgtcacaggggagttcacgggcatgcca
gagcagtgggctcggctactgcagacctccaacatcacgaaatctgagcagaagaaaaac
cctcaggctgtgttggacgtgctcaaattctacgactccacaggcaacagcaggcagaaa
tacctcagcttcacagataaagatgcaccacaagcaaaaaaaggctcagagcaatctcct
gtcaaagaccctgatgatgatgacgaggatgctccaccccctgttgtagcaccacgccca
cagcacaccatatctgtatacactcgttctgtcatcgatcctattccagcacctgctgcc
attgcagacacagatggctctaaagctgcagacaaacagaagaagggcaagggaaagatg
accgatgaggagattatggagaaacttagaaccattgtcagtattggagaccccaagaag
aaatacacaagatacgaaaaaattggacaaggtgcgtctggtacagtgtacacagccatt
gatgttgctactggccaagaggttgctattaagcagattaacctacagaagcagcccaaa
aaagagctgatcatcaatgagatcctggtgatgaaggagctgaagaatccaaacattgtc
aacttcttagacagcttcttggttggagatgagctctttgtggtgatggagtatcttgct
ggaggctctctgacagacgtagtaacagaaacctgcatggatgaggctcaaattgctgct
gtctgcagagagtgtttacaagcactggagtttctgcatgcaaaccaggtcatccatcga
gacatcaaaagtgacaacgttcttttaggaatggacggatcagtcaaactaaccgatttt
gggttctgtgctcaaatcactccagagcaaagcaagaggagcaccatggtgggaacaccc
tactggatggcccctgaggtggtcacacgtaaagcctacgggcccaaagtggacatttgg
tctttgggtatcatggccattgaaatggttgagggcgaacctccatatctcaatgaaaat
cctctgagggcgttgtacctcatcgctactaatggcaccccggagctccagaacccagaa
aagctgtctcccatttttagagacttcctaaaccgctgcctggagatggatgtggagaag
agaggaggaggaaaagagcttctgcaacatcctttcctcaagctggcaaagcctctttcc
agcctcactcctcttatacttgctgccaaggaggcaatgaagagtaaccgttag

DBGET integrated database retrieval system