KEGG   Danio rerio (zebrafish): 266751Help
Entry
266751            CDS       T01004                                 

Gene name
adra2b, zgc:194747
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    266751 (adra2b)
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    266751 (adra2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
8
AA seq 510 aa AA seqDB search
MDSPCPVAVGLPGHTNGTGGTSSPTCNQSMIKLAPYSPEATAAFATAITLMMLITIVGNI
LVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFRSVWCEIYLAL
DVLFCTSSIVHLCAISLDRYMSISRAVTYGPKRTPKRIKCAILVVWLISAVISFPPLLSM
NKNKGGGESGALPQCQLNDERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTRCPPGE
PRKEAPANATTPQHKIQNGRGDETPGTLQKKARPPTLAVSQVESVQQAANTPIANNLLQA
PSTTLTPTTPCPSPSPSNSSEVAPSKSKEGKKEKKKKKNNKNKNKKEPDNNNGESMSSDS
DTEQGGRGLEVPCTPTMTPSGIHSPATMQKYRDMIATAKGAKLVARKAKQDGTPNSARRK
AMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLQAVCPESCALPEPLFKFFFWIGYCNSC
LNPVIYTIFNKDFRRAFKKILCKNTKGTFF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggatagcccgtgccctgttgccgtgggtctgcctggccacactaatggcactggaggc
acgtcttcaccgacttgtaaccagagcatgataaaactcgccccgtactctcctgaagcc
acagcagcctttgcaacagccatcacattgatgatgcttattacaatagtaggcaatatc
ctggtcatcattgctgttttaacaagtcgctcactaagaggaccccaaaatctttttttg
gtctcccttgctgctgcagacattttggtggccaccctcatcatccccttttccttagcc
aatgaactgatgggctactggtatttccgctctgtatggtgtgagatctacctggcgctg
gatgtgttgttctgcacttcctccatagtacatctgtgcgccatcagtctagaccgctac
atgtctatctcacgtgctgtcacgtacggtcccaagcggacaccgaaacgaatcaagtgt
gccattttggtggtgtggttgatctcagcggtaatctcatttccgccactactatctatg
aacaagaataaaggtggtggcgagtcaggtgcgctgcctcagtgtcagctcaacgatgag
cgctggtacatcctgtactctactattggttccttctttgctccttgtctaataatgatc
ttagtctacatgcggatctatcagatcgccaagcagcgcacacggtgtccaccaggggag
ccccgcaaagaagccccagctaatgctacgactcctcagcacaagatccaaaatggaaga
ggagatgaaacgccaggcacccttcagaaaaaagccaggcctccaactttggctgtgtcc
caagtggagtctgtccagcaggcagcaaacaccccgatcgccaacaaccttctgcaagcc
ccttcaacaaccttgacaccaaccaccccatgcccctcgccatctccttcgaattcatct
gaagtggctcccagtaaaagtaaagaggggaaaaaggagaagaagaagaagaagaacaac
aagaacaagaacaagaaagagcctgacaacaataatggagaaagcatgagctctgattcg
gacactgagcaaggtgggagggggttagaggtcccttgcaccccgactatgacccccagt
ggcattcattctcctgccactatgcagaaatacagagacatgatcgccaccgctaaaggt
gccaagctggtggcccgaaaggccaagcaagatggaacgcccaactctgcacgccgcaaa
gcgatggtgaaccgagagaaacgattcacctttgtgttggcggtagtgattggtgtcttt
gtcatttgctggtttcccttcttcttctcatacagcctacaggctgtgtgcccagagtcg
tgcgccctgccagagccactcttcaagttcttcttctggatcggctactgcaacagctgc
ctcaacccggtcatctacaccatcttcaacaaagacttccgcagagccttcaaaaagatc
ctctgcaagaacaccaaaggcacattcttctga

DBGET integrated database retrieval system