KEGG   Danio rerio (zebrafish): 266756Help
Entry
266756            CDS       T01004                                 

Gene name
mapk14b, MAPK14, p38b, zp38b
Definition
mitogen-activated protein kinase 14b (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    266756 (mapk14b)
   04370 VEGF signaling pathway
    266756 (mapk14b)
   04068 FoxO signaling pathway
    266756 (mapk14b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    266756 (mapk14b)
   04621 NOD-like receptor signaling pathway
    266756 (mapk14b)
   04622 RIG-I-like receptor signaling pathway
    266756 (mapk14b)
  Endocrine system
   04912 GnRH signaling pathway
    266756 (mapk14b)
   04914 Progesterone-mediated oocyte maturation
    266756 (mapk14b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    266756 (mapk14b)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    266756 (mapk14b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     266756 (mapk14b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   266756 (mapk14b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
11
AA seq 348 aa AA seqDB search
MSQKARPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVMSAFDGKAGLRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEGFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYISSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITA
SQALAHPYFAQYHDPDDEPEADPYDQSFESRDLEIEEWKSKIYIQNRN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaggcgagacccactttttatcgacaggagctcaataagaccatatgggag
gttccggagcggtaccagaatttatcacccgtgggttctggagcttatggatccgttatg
tccgcgtttgatggtaaggcaggcctgcgggtcgcagtgaagaaactctcccggccgttc
cagtccatcatccacgccaaacgcacgtacagagaactgcggctgctcaaacacatgaag
cacgagaatgtaattggtcttctagatgttttctcgcctgccaccagtctagaaggattc
aatgacgtgtatctggtgactcacctgatgggagcagacctcaataacatcgtcaagtgc
cagaagctgacagatgatcacgtccagttcctcatttatcagatcctgcgggcgttgaag
tacattcattcagcagacatcatccacagagatcttaaacccagtaacctggcagtaaat
gaagactgtgaactgaagattttggactttgggttggcacggctgaccgatgatgagatg
acgggttatgttgccacaagatggtaccgagctccagaaatcatgctcaactggatgcac
tacaacatgacagtggacatctggtcggtgggctgcatcatggctgagctcctcacagga
cggaccctgtttcctggcacagatcatataaaccagcttcagcagataatgcgattgacg
ggaacccctccggcttctctaataagcaggatgccgagccacgaggcaaggaactacatt
agttctcttccccatatgcccaagaggaacttcgcagacgtattcattggcgcaaatcca
ttagcggtggacctgctggagaagatgctggttctggacacagataagcggatcactgcg
tcacaggctctcgctcatccgtatttcgctcagtatcacgatccagacgacgaaccagag
gctgatccgtatgaccagagcttcgagagccgagacctggagatcgaggagtggaaaagt
aagatttacatacaaaataggaattaa

DBGET integrated database retrieval system