KEGG   Danio rerio (zebrafish): 266756Help
Entry
266756            CDS       T01004                                 

Gene name
mapk14b
Definition
(RefSeq) mitogen-activated protein kinase 14B
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    266756 (mapk14b)
   04370 VEGF signaling pathway
    266756 (mapk14b)
   04068 FoxO signaling pathway
    266756 (mapk14b)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    266756 (mapk14b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    266756 (mapk14b)
   04621 NOD-like receptor signaling pathway
    266756 (mapk14b)
   04622 RIG-I-like receptor signaling pathway
    266756 (mapk14b)
  Endocrine system
   04912 GnRH signaling pathway
    266756 (mapk14b)
   04914 Progesterone-mediated oocyte maturation
    266756 (mapk14b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    266756 (mapk14b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    266756 (mapk14b)
  Infectious diseases
   05132 Salmonella infection
    266756 (mapk14b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     266756 (mapk14b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   266756 (mapk14b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
11
AA seq 361 aa AA seqDB search
MSQKARPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSAFDGKAGLRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLV
GTPGPELLMKISSESARNYISSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITA
SQALAHPYFAQYHDPDDEPEADPYDQSFESRDLEIEEWKSLTYEEVMSFEPPVFDGDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaggcgagacccactttttatcgacaggagctcaataagaccatatgggag
gttccggagcggtaccagaatttatcacccgtgggttctggagcttatggatccgtatgc
tccgcgtttgatggtaaggcaggcctgcgggtcgcagtgaagaaactctcccggccgttc
cagtccatcatccacgccaaacgcacgtacagagaactgcggctgctcaaacacatgaag
cacgagaatgtaattggtcttctagatgttttctcgcctgccaccagtctagaagaattc
aatgacgtgtatctggtgactcacctgatgggagcagacctcaataacatcgtcaagtgc
cagaagctgacagatgatcacgtccagttcctcatttatcagatcctgcgggcgttgaag
tacattcattcagcagacatcatccacagagatcttaaacccagtaacctggcagtaaat
gaagactgtgaactgaagattttggactttgggttggcacggctgaccgatgatgagatg
acgggttacgttgccacaagatggtaccgagctccagaaatcatgctcaactggatgcac
tacaacatgacagtggacatctggtcggtgggctgcatcatggctgagctcctcacagga
cggaccctgtttcccggcacagatcacattgatcagttgaagcttatcatgatgctggtc
gggaccccagggcctgagctcttgatgaaaatctcttcagagtctgcaaggaactacatt
agttctcttccccatatgcccaagaggaacttcgcagacgtattcattggcgcaaatcca
ttagcggtggacctgctggagaagatgctggttctggacacagataagcggatcactgcg
tcacaggctctcgctcatccgtatttcgctcagtatcacgatccagacgacgaaccagag
gctgatccgtacgaccagagcttcgagagccgagacctggagatcgaggagtggaaaagt
ctgacgtatgaggaggtgatgagcttcgaaccacccgtatttgatggagacgagatggag
tcctga

DBGET integrated database retrieval system