KEGG   Danio rerio (zebrafish): 266966Help
Entry
266966            CDS       T01004                                 

Gene name
kat6a, bmd, moz, myst3
Definition
K(lysine) acetyltransferase 6A (EC:2.3.1.48)
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     266966 (kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 2247 aa AA seqDB search
MVKLANPLYTTWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEHLELSVKDGSI
LKVSNKGLNSYKDPDNPGRLSFPKPRAGGGGGGGGSGGGGGGGGGGSSTSSSSKKPGLDW
NKLIKRSLEGLHEPGGSSLKSIERFLKCQADVAGYLSGSGSMGPGIFHQQLRLALKRACS
HGRVVKQGPLFRLVSRSSHDGTGCVSLDSLPPVRLLPHEQDRPVAEPIPICSFCLGTKEQ
NRDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSSCQDQGKNADNM
LFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPREKGRKLLHDKAAQIKRRYNAPLGRP
KGRPGRPFKKIRGGGRGRRRRGAGGVDQCSQGSSSPHSSSSSSCEGYPGDDRMLFSLRED
DSAHGSLRFNKKTKGLIDALSKFFTPSPDGRKARAEVVDYSQQYRMRKKGNRKGEHDDRT
GDNQECSDSWREDEDKLPGHENLTEKDVELFRHIQEIALQKVGVTGPPDPQMRCPSVIEF
GKYEIQTWYSSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMRKCNWFHPPANEIYRKD
DVSVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDNKGCHLVGYFSK
EKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAY
WRSVVLECLHEIRDRQLSIRKLSKVTGICPQDITATLLNLNMLEQKGDGVIIMRREKLVA
NHMARLKAKPRLLEVDPDCLRWTPVIVTNTVVSEGEGDEDEEEEGEEERKEIKPSHKSSP
LSWHMKGERENEEEKQSFPAFPKNQSSPPSSSVCNNVLSPERHSNFLAANGERRGPGRPP
KNWLWGKVKDAPRTVPARPRKLKITGDEDDDDDDDDEVEDDDEEEEEEEEDERTGINKVT
ASPSLHSALENEPDSTSACPMEPSRHLTVPPQRNRGRPPRKKRGPKRRLGEEPGDDLPLL
PNNTRLSEPLPVSPAYMSESSEDEEDEEEESRPRSPPILTKPTLGLKSKSQKSLRKRRVR
QRSHPHSSVVTETISETTEVLDEPFVDSDSERPMPRLEEETPFGTPLRCYTAARKHMGPA
LKSISRSNLSESEEDDPTPVLKPIAVLRRPETSDATQRTEETSEMPEVPVKKKKGWPKGK
SRKPLHWKKRPGRKPGSGAGQTDDTDLAVPSSEDPPPSKIKMKPGRKPRSYYLQRAQEEE
VQQEFEQSQLTSQQQQQQQQQQQQQQAQTDNLAQEEKACKRTARALISEISPEKQKDSED
DDDDFLQGFRESSRPKKRGRPPKNANLPSTVPKPPPLSEPEEEDEEEDRWTEEKLSRPPS
RTMSQSSSSRVPQPRANTNMADAEEDEERDDEDCNNRVSRKTATTPGSGSRRSDDHDADD
EGDGRLEEKSDSSSSSKRRKGQDSEDDAEEQEDEEDEEPPSPAHTPPVKEEPQSSESFLD
MQTNVARDYVSKQEDGDEDEDDAEAVQEVKNNSADTDERRRREQEESAAAAAAVETVTAI
ADPSEPMDMQPLHVEDKTVLMMGAEHSHQHPDFKDDLSHQQHTHHHSSELDLETVQAVQS
LTQGEAQEEDAESHEAYQDCEETLAACRTLQSYSHTGEGEEETLALVEECGASQHSPMPN
PPMPTLPNQSVRSVNSPALTPGPMEPGPGVSGPTGTGGGTGGGYTQITPEHPSSLSAPSL
QNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGNGGGNGS
NGGGMSAATAAAVAASSTSSSSSSSSATPSSSSSQGNSCSFVSTPGLTSSSTGVGSQISM
GSCSLIQQTGPGTTNGPGSNSTGGVPQPPPPPPPTSASTPTCGIKSPQGCVIERPPSANQ
QQQKKVSQPPQQQQNPQPQPPPSAPPPPPPQQQALSQCSMGNGFASMPMIMEIPESAGSG
GGGRSLYDRMGQDFGAGGYSLAKLQQLTNTIMDPHGMSYSHSAAVTSYATSVSLSNPGLA
QLASSPHPPLGQAQPTMTPPPNLGSGSMNLGSPLIQCNMTGANIGLPPTPHPQRLQGQMA
TVKGHIAIRSKASQIPAGSPHQQQLYSRSSGAVTMQGSPRTLVQRGMMTNLMPTPAAYNS
VNMNPLNAAMSAGYRMSQPMMNSGYHSNPPYMNQPAQYPMQMQMGMMGGQAYPQQPMQPN
HHGNMMYTGPSHHSYAGVPKQSPYMSR
NT seq 6744 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctggctaacccgctgtacactacctggatcttggaagccatcaagaaggta
aaaaagcaaaagcagcggccgtccgaagaacgtatttgcaatgcggtgtcaatgtcccat
gggcttgaccgcaagacggtcttggagcaccttgagctcagtgttaaagatggttccata
ctcaaggtgtccaacaaggggctcaactcctacaaggaccctgacaaccctggacgttta
tcattcccaaaacccagggcgggaggaggaggaggaggtggtggcagtggtggtggtggt
ggcggcggtggtggtggttccagcacctccagctccagcaaaaagccaggtctggactgg
aacaaactcatcaagcgttctctggaggggcttcatgaacctggaggatcatctctgaag
agcattgaacgctttctaaaatgccaggcagatgttgcaggttatctgtctggcagtggc
tcgatggggccaggcattttccaccagcaactccggctggctctcaagcgggcctgctcc
catggacgggtggttaaacagggacctctttttcggctggtaagcaggagttctcacgat
ggcacaggctgcgtgtctctggattctcttcctcctgtgcgactgctgccccacgaacaa
gaccggcctgtggcagagcctatacccatctgtagtttctgtttggggaccaaggaacag
aatcgtgacaagaagccagaagagctcatctcatgtgcagactgtgggaacagcgggcat
ccatcgtgtctgaagttctctccagagctcacagtgcgggtcaaagctctatggtggcag
tgtatcgagtgcaagacctgcagcagctgccaggaccaaggaaaaaatgcagacaacatg
ttgttctgtgactcctgtgaccgaggcttccacatggagtgctgtgaccctccactaacg
cgaatgccgaaaggcatgtggatctgtcagatctgtcggccaagagaaaagggaagaaag
ctcttacatgacaaagcagcacaaatcaaacggcgatacaatgcaccactggggcgaccg
aagggcagacctggccgtccctttaagaagattcgtggtggagggcgtggccggagaagg
cggggcgctggaggtgtggatcagtgttcacaaggctcctcctccccacactcttcctca
agctcctcctgcgaaggttaccccggtgacgatcgcatgctgttttctctgagagaagat
gactctgcacacggtagcctgcgttttaacaagaaaacaaaaggtttgatcgatgccctc
agcaagttcttcaccccatccccagatggccggaaagcccgtgctgaagtggtggactat
tcccagcaatatcgcatgcgcaagaagggcaaccggaaaggcgagcacgatgacaggaca
ggagacaatcaggagtgctcagacagctggcgggaggatgaagacaagctgccaggacac
gagaatctaaccgagaaagacgtggagctcttcaggcacattcaggaaatcgcactacag
aaagttggggtgactggtccacctgacccccagatgcgctgcccatcagttatagagttt
gggaagtatgaaattcagacgtggtactcttccccatacccacaggagtacagcaggctc
cctaagctctacctctgcgagttctgtctgcgctacatgaagagccgcagtattctctac
cagcacatgcgaaagtgtaactggttccacccgcctgccaacgagatctacaggaaggac
gacgtgtccgtgtttgaggtggatggaaatgtcagcacaatatactgtcagaatctgtgt
ctgcttgccaagctcttcctggaccataagacgctatactatgatgtggagcccttcctt
ttctacgtactcacacagaacgacaataaaggctgccatctcgtgggatacttctcaaag
gagaagcattgtcaacagaagtataacgtgtcctgtatcatgattcttccacaatatcag
cgcaagggctatgggcgattcctcattgacttcagttaccttctttccaaaagggaaggc
cagccgggctcaccagagaagccactgtcagaccttggccggctatcctacatggcatac
tggcgtagtgtggtgttggaatgcctacatgagatcagagatcgacagctctccatccgc
aaactcagcaaagtcacaggcatctgtcctcaagatattacggccaccctgttaaatcta
aacatgctggaacagaaaggggacggggtaattattatgcgcagagaaaagctggtagcc
aatcacatggctcgactgaaagccaaacctcggctccttgaagtcgacccagactgtttg
cgctggacacctgttatcgtcaccaacacagtagtatctgaaggagaaggggatgaggat
gaggaggaggagggagaggaggaacgtaaagagatcaaacccagccacaagagctctccg
ctctcttggcatatgaaaggagaacgggaaaatgaggaagaaaaacagagcttcccagca
ttcccaaaaaaccaaagctctccaccatcctcttccgtttgcaacaatgttctcagtcct
gaacgccactctaattttcttgcagctaatggagagcggaggggaccagggcgtcctccc
aaaaactggttgtggggaaaggtaaaggacgcccctcgtacagttccagctcggcctcga
aaattaaagatcacaggagatgaagatgatgatgatgacgatgatgatgaggtggaggat
gatgatgaagaggaggaagaggaagaagaggatgaaaggactggcatcaataaagtgact
gcatcaccatctttacactcagccttagaaaatgagcctgactctacatcagcctgtccc
atggaaccctccaggcaccttacagttccaccccaacgcaacagaggccggcctccacgg
aaaaagcgtggcccaaaacgcagactcggtgaggaacctggagatgatttgccattgttg
cccaacaacacaaggctgagtgaacccttgccagtttctccagcctatatgagtgagagc
agtgaagatgaggaagatgaggaggaagagtcaagacctcgttcaccacctatcctcaca
aaacccacattaggactaaaaagcaagtctcagaagtccttgcggaagcggcgtgtgcgt
cagcgcagccatccccacagcagtgtagttacagagaccatctcagagacgactgaggtt
ttggatgagccatttgtggattcagattctgaaagacccatgccaagactagaagaggaa
actccttttggtacccctttacgatgctatacagcagcccgaaaacacatgggacctgcc
cttaaaagcatcagcagaagcaatctgtctgaatcagaggaagatgatcccactcctgtg
ctgaagccaattgctgtcctgagaagacctgaaacttccgatgccacacaaagaacagag
gaaacgtctgagatgcctgaggttccagtaaagaagaagaaaggttggcctaagggcaag
agtcgcaagccactccactggaagaaacggccaggcaggaagcctggtagtggagctggt
cagacagatgacaccgatctagcagttccatcctctgaggaccctcctccttcaaaaatc
aaaatgaaacctggcaggaaacctcgtagctattacctgcagcgagcccaagaggaagag
gttcaacaggagtttgaacaaagccagttgacttcgcaacaacaacaacaacaacaacaa
caacaacaacaacaacaggcacaaacagataatttagcacaggaggaaaaagcttgtaaa
aggacagctagagccttgatatctgaaatcagccctgagaagcagaaagactcagaagat
gatgatgatgattttcttcagggttttagagagtcatccaggcccaaaaaacgaggtcgg
ccaccaaaaaatgccaacctcccttccactgttcccaaacctccccctttgtctgagcca
gaagaggaagatgaggaggaagacagatggaccgaggaaaagcttagccgtccaccttct
cgaaccatgtcacagtcttccagctccagagtccctcagccaagagctaacacaaacatg
gcagatgcagaggaagatgaggagcgagatgatgaagattgtaataacagggtcagtcgg
aaaacagctacaacaccaggctctgggagtcggcgtagtgatgaccatgatgctgatgat
gaaggggatggccgtcttgaagaaaaaagtgacagcagcagtagcagtaaaaggcgaaaa
ggccaagactctgaagatgatgcggaggagcaggaggatgaggaagatgaggaaccacca
tcacctgctcacactccacctgtaaaagaagaaccccagagcagtgagagttttttagac
atgcagactaatgtggctcgagactatgtcagcaaacaagaagacggtgacgaagatgaa
gatgatgcagaggcagtgcaggaggtgaagaataactctgctgatactgatgaacgcagg
cgcagagagcaagaggaatctgcagcagctgcggcagctgtcgagacagtaactgcaatt
gcagacccttccgaaccaatggacatgcagcctttacacgttgaggacaaaactgttctc
atgatgggggctgagcactcacaccagcatccagactttaaagatgacctgagccaccag
caacatacacatcaccacagtagtgagctggatctggaaactgtgcaagctgtccagtca
ctcacacaaggtgaggcccaggaggaggatgcagagtcccatgaagcctaccaggactgt
gaggagactctggctgcctgtcgaaccctccaaagttacagtcatacaggtgaaggtgag
gaggaaactctagccttagtggaagagtgtggagcctcccagcatagtcccatgcccaac
ccaccaatgcccacattaccgaaccagtctgtccgttcagtcaacagtcctgcactgact
ccaggtcctatggagcctgggccaggggtgtcgggtcccacaggaactggagggggaaca
ggaggaggctatacccaaataaccccagagcatcccagctctctgtcagctccttctttg
caaaacatggagacctcccctatgatggacgtaccatcagtttctgatcattcacagcaa
gttgtagacagcggcttcagcgacctaggcagcattgagagcaccaccgaaaactatgac
aatccaagcagctatgactcaactatgggtggtggaggaaatggaggagggaatggaagt
aatggaggtggtatgtcagctgccaccgcagcagcggtggctgcttcctctacatcatct
tcatcatcttctagctcagctacaccatcatcgtcatcttcacaaggcaacagctgctcc
tttgtctcaactcctgggttgacatcctcgagcacaggtgttggctctcaaatctccatg
ggaagttgtagccttatccagcaaacaggtcctggcacaaccaatggaccgggttctaac
agtactggtggtgtcccgcaacctccacccccacctcctcctacttctgccagcactcca
acttgcggtataaagtctccacaaggctgcgtcatagaaaggccaccaagtgccaaccag
cagcaacaaaaaaaggtctcgcaaccccctcaacaacaacaaaaccctcaaccacagcct
ccaccctctgctccaccaccccctccacctcaacagcaagccctctcacagtgcagcatg
ggaaacggctttgcttccatgcccatgattatggagattcctgaaagtgcaggcagcggt
ggaggaggtcggagtttgtatgatcgaatgggccaggacttcggtgctggtggttacagt
ttagccaaactccagcagctaacaaacactatcatggacccccatggaatgtcttattcg
cattcagctgcagtcacctcatatgcgacaagtgtttcactgtctaacccagggttagcg
cagcttgcttcttctccacacccacctttgggccaggctcagcccacaatgactccacct
cccaatttgggttctgggtctatgaaccttgggtctcccttaattcagtgcaacatgacg
ggcgctaacatcggactacctcccactccccatccacaacggttgcaaggccaaatggcc
accgtcaaaggccacattgcaatccggtccaaagcctctcaaatacctgcgggctcccct
caccagcagcaattgtacagtcgcagttctggcgctgtgaccatgcagggctccccacgg
actctagttcagcgtggcatgatgaccaacctcatgcccacacctgccgcctacaactca
gtgaacatgaatccactcaatgctgccatgtccgctggctatcgcatgtcacagccaatg
atgaacagtgggtaccacagtaacccgccctatatgaaccagccagcccaataccccatg
caaatgcaaatgggaatgatgggagggcaggcttaccctcagcagcctatgcagcccaat
caccatggcaacatgatgtacacgggcccctcgcaccacagctacgctggcgtccccaaa
cagtcgccttacatgagcagatga

DBGET integrated database retrieval system