KEGG   Danio rerio (zebrafish): 282677Help
Entry
282677            CDS       T01004                                 

Gene name
bckdk, cb233, wu:fa04g07, wu:fb80b08, zgc:55984
Definition
branched chain alpha-ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 419 aa AA seqDB search
MELLGSGGCRISVTRLFLSPSAKAAAPVTGAHGVGRRFRSTSSMSSYSELARERSKTVTS
FYDQSAIDASAEKPSVRLTPATMLYAGKSPDGQHILSSARYLHKELPVRIAHRIKGFRSL
PFIIGCNPTILQVHELYIRAYHMLSDFPAIQDQETEARYSKMVKQLLDDHKDVVTMLAEG
FRECRKHILDEMLVRNFLDTTLTSRLGIRMLATHHIALHEDNPDFVGIICRRLSPKKIIE
KWVDFARRLCEHQYGNSPRVRINGHVAARFPFIPLPLDYILPELLKNAMRATMESHLDTP
YNVPDVVVTIANNDTDFVIRISDRGGGIPHSILDKVMHYHFSTAEQSAQDPRMSNLFDSM
TNSGPQSGPMHGFGFGLPTSRAYAEYLGGSLAIQSMQGIGTDVYLRLRHIDGKGESFRV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggagttgctgggcagcggcggctgtaggatcagcgtgaccaggctctttctgtccccg
tcagccaaagcagccgctccggtgaccggggctcatggcgtcggcagaaggtttcggtca
acatcctccatgtccagctactcggagctggctcgggagcggtccaaaaccgttacgtct
ttttacgaccagtccgccatcgacgcatccgccgagaagccttctgtcagactgacacca
gccactatgctatacgcagggaagtctcctgacggacagcatatcttgagcagtgccagg
tatctacacaaagagctgcctgtccgtattgcccatcgcattaagggcttccgtagcctg
cccttcattatcggctgcaacccaaccattctccaagtgcatgagctttatatcagggcc
taccacatgctgagcgacttcccagctattcaagaccaggagaccgaggctcgctatagt
aagatggtaaaacagcttcttgatgatcacaaggatgttgtcaccatgttagctgaagga
ttcagggaatgtcgtaaacacatattggatgagatgctggttcgtaatttcttggacaca
acgttgacgtctcgtctgggcatccgcatgctggccacacaccacattgccctgcatgaa
gataaccctgactttgtagggatcatatgccgccgcttatcccccaaaaagatcatcgag
aaatgggttgattttgctcgacggctctgtgagcatcagtacggtaactctccgcgtgtt
cgcatcaacggccacgtggcagcccgctttcccttcattccactgcctctggattacatc
ctgcctgaactgctgaagaacgccatgagggccaccatggagagtcacttggacacccct
tataatgtgcctgatgtggtggtcacaattgccaacaatgacactgactttgtcataagg
atctcggaccgtggtggtggcattcctcacagcattttggacaaggtgatgcattatcac
ttcagtacagcagagcagagcgctcaagatccccgcatgagcaaccttttcgatagcatg
accaacagcggccctcagtccggacccatgcatgggtttggcttcggtctgcccacatcc
agagcgtacgccgaatacctgggcggatccttggccatccagtcaatgcagggcatcggc
acggatgtctacctgcgccttcgacacattgacggcaaaggagagagcttcagagtttga

DBGET integrated database retrieval system