KEGG   Danio rerio (zebrafish): 282677Help
Entry
282677            CDS       T01004                                 

Gene name
bckdk, cb233, wu:fa04g07, wu:fb80b08, zgc:55984
Definition
(RefSeq) branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
  KO
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     282677 (bckdk)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   282677 (bckdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 428 aa AA seqDB search
MRGRVTGQAMELLGSGGCRISVTRLFLSPSAKAAAPVTGAHGVGRRFRSTSSMSSYSELA
RERSKTVTSFYNQSAIDASAEKPSVRLTPATMLYAGKSPDGQHILSSARYLHKELPVRIA
HRIKGFRSLPFIIGCNPTILQVHELYIRAYHMLSDFPAIQDQETEARYSKMVKQLLDDHK
DVVTMLAEGFRECRKHILDEMLVRNFLDTTLTSRLGIRMLATHHIALHEDNPDFVGIICR
RLSPKKIIEKWVDFARRLCEHQYGNSPRVRINGHVAARFPFIPLPLDYILPELLKNAMRA
TMESHLDTPYNVPDVVVTIANNDTDFVIRISDRGGGIPHSILDKVMHYHFSTAEQSAQDP
RMSNLFDSMTNSGPQSGPMHGFGFGLPTSRAYAEYLGGSLAIQSMQGIGTDVYLRLRHID
GKGESFRV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggacgcgtgacaggccaggccatggagttgctgggcagcggcggctgtaggatc
agcgtgaccaggctctttctgtccccgtcagccaaagcagccgctccggtgaccggggct
catggcgtcggcagaaggtttcggtcaacatcctccatgtccagctactcggagctggct
cgggagcggtccaaaaccgttacgtctttttacaaccagtccgccatcgacgcatccgcc
gagaagccttctgtcagactgacaccagccactatgctatacgcagggaagtctcctgac
ggacagcatatcttgagcagtgccaggtatctacacaaagagctgcctgtccgtattgcc
catcgcattaagggcttccgtagcctgcccttcattatcggctgcaacccaaccattctc
caagtgcatgagctttatatcagggcctaccacatgctgagcgacttcccagctattcaa
gaccaggagaccgaggctcgctatagtaagatggtaaaacagcttcttgatgatcacaag
gatgttgtcaccatgttagctgaaggattcagggaatgtcgtaaacacatattggatgag
atgctggttcgtaatttcttggacacaacgttgacgtctcgtctgggcatccgcatgctg
gccacacaccacattgccctgcatgaagataaccctgactttgtagggatcatatgccgc
cgcttatcccccaaaaagatcatcgagaaatgggttgattttgctcgacggctctgtgag
catcagtacggtaactctccgcgtgttcgcatcaacggccacgtggcagcccgctttccc
ttcattccactgcctctggattacatcctgcctgaactgctgaagaacgccatgagggcc
accatggagagtcacttggacaccccttataatgtgcctgatgtggtggtcacaattgcc
aacaatgacactgactttgtcataaggatctcggaccgtggtggtggcattcctcacagc
attttggacaaggtgatgcattatcacttcagtacagcagagcagagcgctcaagatccc
cgcatgagcaaccttttcgatagcatgaccaacagcggccctcagtccggacccatgcat
gggtttggcttcggtctgcccacatccagagcgtacgccgaatacctgggcggatccttg
gccatccagtcaatgcagggcatcggcacggatgtctacctgcgccttcgacacattgat
ggcaaaggagagagcttcagagtttga

DBGET integrated database retrieval system