KEGG   Danio rerio (zebrafish): 286832Help
Entry
286832            CDS       T01004                                 

Gene name
lamc1, sly
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dre04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 1593 aa AA seqDB search
MSLFSCLLLWTLWAACSHGAMDECIDEDDRPQRCMPEFVNAAFNATVVATNTCGSPPEEF
CVQTGVTGVTKSCHICNAADPRLHHGAVYLTDYNQPVQPTWWQSQTMLAGIQYPNSINLT
LHLGKSFDITYVRLKFHTSRPESFAIYKRSSEDGPWTPYQYYSGSCEKTYSKNNRGFIRT
GEDEQQALCTDEFSDISPLYGGNVAFSTLEGRPSAYNFDNSPVLQDWVTATDIRVTLNRL
NTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEYSKLVCNCKHNTEGADC
NVCKPFYNDRPWRRATAENPNECLPCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDG
PKCERCLANYYREASGQRCLSCGCNPVGSLSTQCDNTGRCSCKPGVMGDKCDRCQPGYHS
LSEAGCRPCSCNPAGSTQECDVQTGRCQCKENVDGFNCDRCKLGYFNLDPQNPQGCTPCF
CFQHSTVCESADGYSVHKITSTFDRDDEGWKGKQRDDSSVPVQWSPSSGEISLISEDYFP
IYFVAPDKFLHNQLLSYGQNLTLNFRIQRHDARLSAEDVVLEGSGLRVAVPLIAQGNSYP
GEETQTFVFRLHDTTDYPWRPTIKHADFQKLLYNLTSIMIRGTYSAQSAGYLDNVSLVTA
RRGPGTPARWVEKCTCPQGYLGQHCEQCDQGFRRSRPELRRFSTCERCNCNGHSDTCDPE
TGMCNCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCPAGATCAVVPKTNEVVCTNCP
TGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCNNNIEPNAVGNCNRESGECLKCIYNT
AGVFCDRCKQGFYGDARAANVADKCKPCKCSPYGTVDRQTACSQVTGQCPCLPHVINRDC
GACELGFYNLQSGKGCERCNCNPIGSTNGQCDIVSGQCECQPGVTGQHCERCEVNFFGFS
SSGCKPCDCDPEGSESAQCKEDGRCHCRPGFVGSRCDMCEENYFYNRSTPGCQQCPNCYS
LVRDKVNQQRQKLLDLQNLIDSLDNTETTVSDKAFEDRLKEAEKTIMDLLEEAQASKEVD
KGLLDRLNNINKTLNNQWNRLQNIKNTVDNTGAQADRARNRVRDAENLINTAREELDKAK
EAISKVDIKIPTTSGDPNNMTLLAEEARKLSEKHKADADQIEKIAKDANDTSTKAYNMLK
KALDGENKTSSDIDELNRKYLEAKDLAKNLEKQAAKVHAEAEEAGNKALKIYANLTSLPP
INTKTLEDDANKIKKEASDLDKLIDKTEKEYNDLREDLRGKETEVRKLLDKGKTEQQTAD
QLLARADAAKALAEEAAKKGKSTFQEAQDILNNLRDFDKRVNDNKTAAEDAMRRIPQINA
TINEANDKTRRAEAALGNAAADAKDAKAKAEEAEKIANDVQKGSAKTKADAEKAFEDTMK
LDKDVDKMMDQLTAAEKELEKKKAEADTDMMMASMASDNAKDAEGNARKAKSAVREVLNT
INALLGQLGNIDKVDLSKLNQIDNALKDAKDKMAGSELDRKLKELNDIAKSQEDMISDYD
RQIQEIRADIANLNDIKNTLPEGCFNTPSLERP
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttttagctgtttgttgttatggactttgtgggcagcgtgcagtcacggagcg
atggatgaatgtatagacgaggatgatcggcctcagcgctgcatgccggagttcgttaac
gcggctttcaatgcgaccgtggtggccaccaacacttgcggctcgccgcctgaagagttc
tgcgtacagaccggggttacgggagtcactaaatcatgccacatttgcaatgccgcggac
cccagactgcaccacggcgctgtttatctcaccgattacaaccaaccagtacaaccaacc
tggtggcaaagccagactatgttagcgggcatccagtacccgaactccatcaacttgacc
cttcacctgggcaaatctttcgacatcacctatgtgcgtttgaagttccacaccagccgt
cctgagagttttgccatctacaagcgctccagtgaagacgggccttggaccccctaccaa
tactacagtggctcctgtgagaaaacctacagcaaaaacaaccgtggcttcatccgcacg
ggcgaggacgagcagcaggctctgtgtacagatgagtttagcgacatctcgccactctat
ggaggaaacgtggctttctctacgctcgagggccgacccagtgcatataacttcgacaac
agccctgtactgcaggattgggtaactgccactgatatcagagtgaccctgaatcgatta
aacactttcggagatgaagttttcaacgatcccaaagtcctcaaatcctactactacgcc
atctcggattttgctgtgggaggaaggtgcaagtgcaatggccatgccagcgagtgcgtg
aagaacgagtacagcaagctggtgtgtaactgcaaacacaacacagaaggagccgactgc
aatgtgtgcaaacccttctataatgaccgtccctggaggagagccactgctgaaaaccct
aatgagtgtctgccttgtaactgtaatggaaagagcgctgaatgttacttcgaccctgag
ctgtatcgtgccactggtcacggaggtcactgccgtaactgtgctgacaatacagatggg
ccgaagtgtgagcgatgcctggccaactactacagagaggcctccggtcagcgctgtctg
tcctgcggctgcaaccctgttgggtctctcagcactcagtgtgataacactggcagatgc
agctgtaagccaggagtgatgggagacaagtgtgacagatgccaacctggataccactcg
ctctctgaggcaggatgcagaccgtgctcttgtaatccagccggaagcacacaggagtgt
gatgtccagaccggacgctgccagtgcaaggaaaatgtggacggattcaactgtgaccgg
tgtaaactgggctattttaatctggacccccagaatcctcagggctgcactccatgcttc
tgcttccagcattcgacagtgtgtgagagcgcagacggctacagtgtgcacaaaatcacc
tccacctttgacagagatgatgaaggctggaagggtaaacagagagatgactccagtgta
ccggtacagtggtcacccagttctggagagatctcactcatctcagaagattacttcccc
atctactttgtggctccagataaatttctgcataatcagctgttgagttatggtcagaac
ctcacgctgaacttcaggattcagcgtcacgatgctcgcctctcagcagaggacgttgtg
ctggagggctcggggcttcgtgtcgctgtgcctcttattgctcagggtaattcctaccca
ggagaggagacccaaacctttgtgttcagactacatgacacaactgactacccttggaga
cccaccataaagcatgcagacttccagaaacttctctacaatctgacttcaatcatgatc
cgtggaacctacagcgcacaaagtgctggttatttggataacgtgtctctggtgactgcc
cgccggggccctggcactccggcccgatgggttgagaaatgcacgtgtccgcagggttat
ttgggtcagcattgtgagcagtgcgatcagggattcaggaggagccggccagagctgcga
cgcttcagcacctgcgagcgctgcaactgcaatggacacagcgacacatgtgaccctgag
acaggaatgtgtaactgccagcacaacactgctggtttgagctgtgaaaggtgtaaagac
ggcttctatggtgattctacagtgggctcttcttcagactgtaaagcctgtccctgccct
gctggtgccacctgtgctgtggtgcccaagaccaatgaggtggtctgtaccaactgcccg
actggaaccacaggtaaacgatgtgagctgtgtgacgatggtttctttggagatcctctg
ggtgagaaaggtccagtgagagcgtgtcgagcctgcagctgcaacaacaacatcgagccg
aacgctgtgggcaactgtaaccgagagtcgggcgaatgcctcaagtgcatctacaacacc
gctggcgtcttttgcgaccgctgcaagcagggcttctatggtgatgcccgcgctgctaat
gtagccgacaaatgcaaaccgtgcaagtgttctccatatggtacagtagaccgacagaca
gcctgttctcaggtgacgggtcaatgtccgtgtctccctcacgtcattaacagagactgt
ggcgcttgtgaactgggtttctacaatctgcagagtggaaagggctgtgaacgatgcaac
tgcaaccctattggttccacgaatggtcagtgtgacattgtcagcggtcagtgtgagtgt
cagcctggagtcaccggtcaacattgtgagcgatgcgaggtcaacttcttcggattcagt
tcatcgggttgcaaaccatgtgactgtgacccagaaggctcagaatcagctcagtgtaag
gaggacggccgctgtcattgtcggccaggttttgtgggctctcgctgtgatatgtgtgag
gaaaactacttctacaaccgctcgacacctggctgccagcagtgccctaactgttacagc
ctggtcagagacaaggtaaaccagcagagacaaaaactgcttgacctgcagaatttgatt
gatagtctggacaacactgagacgacagtgagcgacaaggcctttgaggacagactgaag
gaggcagagaaaactataatggacttgctggaagaggctcaggctagcaaagaagtggat
aaaggtcttttggaccgtctaaacaacatcaacaagaccctgaataaccagtggaacaga
ctgcagaacatcaagaacacagtagacaacacaggagcacaggcagacagagcacgaaac
cgcgttcgtgatgcagaaaacctgatcaacacagccagagaggagctggacaaagccaaa
gaagccatcagtaaagtggacattaaaatacctacaacctctggagatccaaacaatatg
acgcttctggcagaggaagcccgtaagctgtcagaaaaacataaagcagatgcagatcag
attgagaagatcgcgaaagatgccaatgacacttctactaaagcctataatatgctgaag
aaagcacttgatggagagaacaagacaagcagcgacattgatgaactcaacaggaagtat
ttggaagcgaaagatctggccaaaaatctggagaagcaggcagctaaagttcatgctgag
gcagaagaggccggaaacaaagctctgaagatctatgctaacctgaccagcttacctcca
atcaacaccaaaacattagaggatgatgccaataagattaaaaaggaggcttcagacttg
gacaaactgatagacaagactgagaaggagtacaatgacttgagagaagacttgagagga
aaagagacggaggtccgcaaactgctggacaaaggaaaaactgagcaacagacggctgat
cagttgttggcgcgtgcagacgcagcaaaggctttggctgaggaggcggcaaaaaaaggc
aaatctactttccaagaggctcaggatattctgaacaacctcagagatttcgacaagcga
gtgaatgacaacaaaactgctgctgaggatgccatgaggagaatcccacaaatcaatgca
acaatcaatgaagccaatgataaaaccagacgggccgaggcggctttaggcaatgcagct
gctgatgctaaagatgctaaagcgaaggcagaggaagctgagaaaatcgctaatgatgtg
cagaagggttctgcaaagaccaaggcagacgcagaaaaggcttttgaagacaccatgaaa
ctggataaagatgttgacaaaatgatggaccagctcacagcagcggagaaagagctggaa
aagaagaaagcagaggcggacactgacatgatgatggcatctatggcatcagacaatgcc
aaagatgcagagggcaatgccagaaaagccaaaagtgctgtcagagaagtactcaacaca
atcaatgcactgctaggccaactcggtaacatcgataaggtggatctgagcaagctgaat
cagatcgacaacgctctcaaagatgccaaggacaaaatggcgggaagtgagctggacagg
aagctgaaggagctgaacgacatcgccaagagtcaggaggacatgatcagcgactacgac
cgtcagatccaggagattcgagcagacattgccaacctgaacgacatcaagaacactctg
cccgagggctgcttcaacacgccgtctctagagcggccataa

DBGET integrated database retrieval system