KEGG   Danio rerio (zebrafish): 286832Help
Entry
286832            CDS       T01004                                 

Gene name
lamc1, sly
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    286832 (lamc1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    286832 (lamc1)
Cell adhesion molecules and their ligands [BR:dre04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      286832 (lamc1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      286832 (lamc1)
     Laminin-2 Extracellular matrix (ECM) components
      286832 (lamc1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      286832 (lamc1)
   VLA-3
      286832 (lamc1)
     Laminin-10 Extracellular matrix (ECM) components
      286832 (lamc1)
     Laminin-11 Extracellular matrix (ECM) components
      286832 (lamc1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      286832 (lamc1)
     Laminin-8 Extracellular matrix (ECM) components
      286832 (lamc1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      286832 (lamc1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      286832 (lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 1593 aa AA seqDB search
MSLFSCLLLWTLWAACSHGAMDECIDEDDRPQRCMPEFVNAAFNATVVATNTCGSPPEEF
CVQTGVTGVTKSCHICNAADPRLHHGAVYLTDYNQPVQPTWWQSQTMLAGIQYPNSINLT
LHLGKSFDITYVRLKFHTSRPESFAIYKRSSEDGPWTPYQYYSGSCEKTYSKNNRGFIRT
GEDEQQALCTDEFSDISPLYGGNVAFSTLEGRPSAYNFDNSPVLQDWVTATDIRVTLNRL
NTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEYSKLVCNCKHNTEGADC
NVCKPFYNDRPWRRATAENPNECLPCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDG
PKCERCLANYYREASGQRCLSCGCNPVGSLSTQCDNTGRCSCKPGVMGDKCDRCQPGYHS
LSEAGCRPCSCNPAGSTQECDVQTGRCQCKENVDGFNCDRCKLGYFNLDPQNPQGCTPCF
CFQHSTVCESADGYSVHKITSTFDRDDEGWKGKQRDDSSVPVQWSPSSGEISLISEDYFP
IYFVAPDKFLHNQLLSYGQNLTLNFRIQRHDARLSAEDVVLEGSGLRVAVPLIAQGNSYP
GEETQTFVFRLHDTTDYPWRPTIKHADFQKLLYNLTSIMIRGTYSAQSAGYLDNVSLVTA
RRGPGTPARWVEKCTCPQGYLGQHCEQCDQGFRRSRPELRRFSTCERCNCNGHSDTCDPE
TGMCNCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCPAGATCAVVPKTNEVVCTNCP
TGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCNNNIEPNAVGNCNRESGECLKCIYNT
AGVFCDRCKQGFYGDARAANVADKCKPCKCSPYGTVDRQTACSQVTGQCPCLPHVINRDC
GACELGFYNLQSGKGCERCNCNPIGSTNGQCDIVSGQCECQPGVTGQHCERCEVNFFGFS
SSGCKPCDCDPEGSESAQCKEDGRCHCRPGFVGSRCDMCEENYFYNRSTPGCQQCPNCYS
LVRDKVNQQRQKLLDLQNLIDSLDNTETTVSDKAFEDRLKEAEKTIMDLLEEAQASKEVD
KGLLDRLNNINKTLNNQWNRLQNIKNTVDNTGAQADRARNRVRDAENLINTAREELDKAK
EAISKVDIKIPTTSGDPNNMTLLAEEARKLSEKHKADADQIEKIAKDANDTSTKAYNMLK
KALDGENKTSSDIDELNRKYLEAKDLAKNLEKQAAKVHAEAEEAGNKALKIYANLTSLPP
INTKTLEDDANKIKKEASDLDKLIDKTEKEYNDLREDLRGKETEVRKLLDKGKTEQQTAD
QLLARADAAKALAEEAAKKGKSTFQEAQDILNNLRDFDKRVNDNKTAAEDAMRRIPQINA
TINEANDKTRRAEAALGNAAADAKDAKAKAEEAEKIANDVQKGSAKTKADAEKAFEDTMK
LDKDVDKMMDQLTAAEKELEKKKAEADTDMMMASMASDNAKDAEGNARKAKSAVREVLNT
INALLGQLGNIDKVDLSKLNQIDNALKDAKDKMAGSELDRKLKELNDIAKSQEDMISDYD
RQIQEIRADIANLNDIKNTLPEGCFNTPSLERP
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttttagctgtttgttgttatggactttgtgggcagcgtgcagtcacggagcg
atggatgaatgtatagacgaggatgatcggcctcagcgctgcatgccggagttcgttaac
gcggctttcaatgcgaccgtggtggccaccaacacttgcggctcgccgcctgaagagttc
tgcgtacagaccggggttacgggagtcactaaatcatgccacatttgcaatgccgcggac
cccagactgcaccacggcgctgtttatctcaccgattacaaccaaccagtacaaccaacc
tggtggcaaagccagactatgttagcgggcatccagtacccgaactccatcaacttgacc
cttcacctgggcaaatctttcgacatcacctatgtgcgtttgaagttccacaccagccgt
cctgagagttttgccatctacaagcgctccagtgaagacgggccttggaccccctaccaa
tactacagtggctcctgtgagaaaacctacagcaaaaacaaccgtggcttcatccgcacg
ggcgaggacgagcagcaggctctgtgtacagatgagtttagcgacatctcgccactctat
ggaggaaacgtggctttctctacgctcgagggccgacccagtgcatataacttcgacaac
agccctgtactgcaggattgggtaactgccactgatatcagagtgaccctgaatcgatta
aacactttcggagatgaagttttcaacgatcccaaagtcctcaaatcctactactacgcc
atctcggattttgctgtgggaggaaggtgcaagtgcaatggccatgccagcgagtgcgtg
aagaacgagtacagcaagctggtgtgtaactgcaaacacaacacagaaggagccgactgc
aatgtgtgcaaacccttctataatgaccgtccctggaggagagccactgctgaaaaccct
aatgagtgtctgccttgtaactgtaatggaaagagcgctgaatgttacttcgaccctgag
ctgtatcgtgccactggtcacggaggtcactgccgtaactgtgctgacaatacagatggg
ccgaagtgtgagcgatgcctggccaactactacagagaggcctccggtcagcgctgtctg
tcctgcggctgcaaccctgttgggtctctcagcactcagtgtgataacactggcagatgc
agctgtaagccaggagtgatgggagacaagtgtgacagatgccaacctggataccactcg
ctctctgaggcaggatgcagaccgtgctcttgtaatccagccggaagcacacaggagtgt
gatgtccagaccggacgctgccagtgcaaggaaaatgtggacggattcaactgtgaccgg
tgtaaactgggctattttaatctggacccccagaatcctcagggctgcactccatgcttc
tgcttccagcattcgacagtgtgtgagagcgcagacggctacagtgtgcacaaaatcacc
tccacctttgacagagatgatgaaggctggaagggtaaacagagagatgactccagtgta
ccggtacagtggtcacccagttctggagagatctcactcatctcagaagattacttcccc
atctactttgtggctccagataaatttctgcataatcagctgttgagttatggtcagaac
ctcacgctgaacttcaggattcagcgtcacgatgctcgcctctcagcagaggacgttgtg
ctggagggctcggggcttcgtgtcgctgtgcctcttattgctcagggtaattcctaccca
ggagaggagacccaaacctttgtgttcagactacatgacacaactgactacccttggaga
cccaccataaagcatgcagacttccagaaacttctctacaatctgacttcaatcatgatc
cgtggaacctacagcgcacaaagtgctggttatttggataacgtgtctctggtgactgcc
cgccggggccctggcactccggcccgatgggttgagaaatgcacgtgtccgcagggttat
ttgggtcagcattgtgagcagtgcgatcagggattcaggaggagccggccagagctgcga
cgcttcagcacctgcgagcgctgcaactgcaatggacacagcgacacatgtgaccctgag
acaggaatgtgtaactgccagcacaacactgctggtttgagctgtgaaaggtgtaaagac
ggcttctatggtgattctacagtgggctcttcttcagactgtaaagcctgtccctgccct
gctggtgccacctgtgctgtggtgcccaagaccaatgaggtggtctgtaccaactgcccg
actggaaccacaggtaaacgatgtgagctgtgtgacgatggtttctttggagatcctctg
ggtgagaaaggtccagtgagagcgtgtcgagcctgcagctgcaacaacaacatcgagccg
aacgctgtgggcaactgtaaccgagagtcgggcgaatgcctcaagtgcatctacaacacc
gctggcgtcttttgcgaccgctgcaagcagggcttctatggtgatgcccgcgctgctaat
gtagccgacaaatgcaaaccgtgcaagtgttctccatatggtacagtagaccgacagaca
gcctgttctcaggtgacgggtcaatgtccgtgtctccctcacgtcattaacagagactgt
ggcgcttgtgaactgggtttctacaatctgcagagtggaaagggctgtgaacgatgcaac
tgcaaccctattggttccacgaatggtcagtgtgacattgtcagcggtcagtgtgagtgt
cagcctggagtcaccggtcaacattgtgagcgatgcgaggtcaacttcttcggattcagt
tcatcgggttgcaaaccatgtgactgtgacccagaaggctcagaatcagctcagtgtaag
gaggacggccgctgtcattgtcggccaggttttgtgggctctcgctgtgatatgtgtgag
gaaaactacttctacaaccgctcgacacctggctgccagcagtgccctaactgttacagc
ctggtcagagacaaggtaaaccagcagagacaaaaactgcttgacctgcagaatttgatt
gatagtctggacaacactgagacgacagtgagcgacaaggcctttgaggacagactgaag
gaggcagagaaaactataatggacttgctggaagaggctcaggctagcaaagaagtggat
aaaggtcttttggaccgtctaaacaacatcaacaagaccctgaataaccagtggaacaga
ctgcagaacatcaagaacacagtagacaacacaggagcacaggcagacagagcacgaaac
cgcgttcgtgatgcagaaaacctgatcaacacagccagagaggagctggacaaagccaaa
gaagccatcagtaaagtggacattaaaatacctacaacctctggagatccaaacaatatg
acgcttctggcagaggaagcccgtaagctgtcagaaaaacataaagcagatgcagatcag
attgagaagatcgcgaaagatgccaatgacacttctactaaagcctataatatgctgaag
aaagcacttgatggagagaacaagacaagcagcgacattgatgaactcaacaggaagtat
ttggaagcgaaagatctggccaaaaatctggagaagcaggcagctaaagttcatgctgag
gcagaagaggccggaaacaaagctctgaagatctatgctaacctgaccagcttacctcca
atcaacaccaaaacattagaggatgatgccaataagattaaaaaggaggcttcagacttg
gacaaactgatagacaagactgagaaggagtacaatgacttgagagaagacttgagagga
aaagagacggaggtccgcaaactgctggacaaaggaaaaactgagcaacagacggctgat
cagttgttggcgcgtgcagacgcagcaaaggctttggctgaggaggcggcaaaaaaaggc
aaatctactttccaagaggctcaggatattctgaacaacctcagagatttcgacaagcga
gtgaatgacaacaaaactgctgctgaggatgccatgaggagaatcccacaaatcaatgca
acaatcaatgaagccaatgataaaaccagacgggccgaggcggctttaggcaatgcagct
gctgatgctaaagatgctaaagcgaaggcagaggaagctgagaaaatcgctaatgatgtg
cagaagggttctgcaaagaccaaggcagacgcagaaaaggcttttgaagacaccatgaaa
ctggataaagatgttgacaaaatgatggaccagctcacagcagcggagaaagagctggaa
aagaagaaagcagaggcggacactgacatgatgatggcatctatggcatcagacaatgcc
aaagatgcagagggcaatgccagaaaagccaaaagtgctgtcagagaagtactcaacaca
atcaatgcactgctaggccaactcggtaacatcgataaggtggatctgagcaagctgaat
cagatcgacaacgctctcaaagatgccaaggacaaaatggcgggaagtgagctggacagg
aagctgaaggagctgaacgacatcgccaagagtcaggaggacatgatcagcgactacgac
cgtcagatccaggagattcgagcagacattgccaacctgaacgacatcaagaacactctg
cccgagggctgcttcaacacgccgtctctagagcggccataa

DBGET integrated database retrieval system