KEGG   Danio rerio (zebrafish): 30140Help
Entry
30140             CDS       T01004                                 

Gene name
clocka, clock, zCLOCK1, zfCLOCK1
Definition
clock circadian regulator a (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    30140 (clocka)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     30140 (clocka)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    30140 (clocka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
20
AA seq 893 aa AA seqDB search
MTSSIDRDDSSIFDGLMEEDEKDKAKRVSRNRSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQKSIDFLRKHKEIAAQSESSEIRQDWKPPFLSNEEFTQLMLEALDGFFLAIMTDG
NIIYVSESVTSLLEHLPSDLVDQNLLNFLPLGEHSEVYKALSTHMLEGETLTPDYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNTVPNSTRNGFEGVIQRSLRHAFEDRV
CFIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESPPEISADKSQDSGSESQLNTSSLKEALERFDHSRT
PSASSRSSRKSSSHTAVSDPTSTQTKLQTDRSTPPRQSVSAIEMTSQRRSSISSQSMSSQ
TTGQTMGTSLVSQPQQPQTLQATVQPVLQFSTQMDAMQHLKEQLEQRTRMIEANIQRQQE
ELRQIQDELQRVQGQGLQMFLQPSGGGLNLSSVQLTQSSSVQTAGTLSMQGAVVPTATLQ
SSLQSTHSSTQHTVTQHPQQTAVQQQNLLRDQTTNLNQQSQRSTHTLQSPQGALPASLYN
TMMISQPTQANVVQISTSLAQNSSTSGAAVDLLTKDPTDYRFPATQQLLTKLVTGPMACG
AVMVPTTMFMGQVVTAFAPQQGQPQTISIAQQPSAQTADQQTHTQAQTQAAATAQQQGQN
QAQLTQQQTQFLQAPRLLHSNQSTQLILQAAFPLQQQGTFTTATQQQQQLHQQQQQLQQQ
QQLQQQQQQQQQQLQQQHQQQQQQLQQQHQQQQQQLAAHRSDSMTERSNPPPQ
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgacctccagcatagaccgggatgacagcagtatctttgatgggttaatggaagaagat
gagaaggacaaagcaaaaagagtttctagaaataggtcggagaagaagaggcgagaccag
ttcaatgtgctcatcaaggaactgggcaccatgttgccgggcaacacccgcaagatggac
aagtctaccatcctacagaagagcatcgacttcctgcgcaagcacaaagaaattgctgca
cagtcggagtcgagtgaaatccgtcaggactggaagccacccttccttagcaatgaggag
ttcacacagctgatgctggaggcactagatggcttctttctggccattatgacggatgga
aacataatctacgtctcagaaagtgtcacgtctttattagaacatctaccttctgatctt
gtggatcagaacctgttgaatttccttccactgggtgagcattcggaggtgtataaagct
ctgtcaacacacatgttggagggagaaaccctcaccccagactacctaaagacaaagaac
cagttggagttttgttgccacatgctccggggcaccatcgaccccaaagagccgcccgtt
tatgaatatgtcaagttcatcggaaactttaagtccctcaacactgtgcctaactcaaca
cgaaacggctttgagggagtgatccagcgatcgctgcgacacgcgtttgaagaccgagtg
tgtttcatagcgacggtcaggctagccaaacctcagtttatcaaggaaatgtgtactgtg
gaggagcccaatgaggaattcacctccagacacagtttagagtggaaattcctcttcttg
gaccacagggcgcctcctatcattggttacctgccgtttgaggttctgggtacttcaggg
tacgactactatcatgtggatgacctggagactttggccaaatgccacgaacacttgatg
cagtacggtaaggggaagtcgtgctattaccgttttctgactaaaggtcagcagtggatc
tggcttcagacgcactactacatcacctaccaccagtggaactcaaggccagagttcatc
gtctgcactcacacggtggtcagttatgctgaagtgagagctgaacagcgcagagagctg
ggcattgaagaatcacctcctgagatctccgcagacaagtctcaggactctggctccgag
tctcagttgaacacctccagcttgaaggaggccctagagcgattcgatcacagccgcaca
ccctcagcctcgtcacgcagctcccgcaagtcctcctcgcacaccgctgtctctgacccc
acctccacacagaccaagctgcagacagatcgcagcacaccacctcgccaatcagtgtca
gccattgagatgacatcacagcggaggtcctccattagcagtcagtcgatgagttctcag
accacaggacagacgatgggaacatctcttgtgtctcagcctcagcagcctcaaacactt
caggccaccgttcagccggtgctgcagttttccacacagatggatgcaatgcagcatctg
aaggagcagctggagcagcgcacacgcatgattgaggcaaacatccagagacagcaggag
gagctacggcagatccaggacgagctgcagagggttcaaggacagggtttacagatgttt
ctgcagccgagtggtggtggattgaacctcagctcagtgcagctgacacagagctcatct
gtacagacagcaggcactctgtccatgcagggggcagtggtgcctacggcgaccctgcag
agcagcctgcagtccacacacagcagcacacaacacacggtcacacagcatcctcagcag
acagcagtgcagcagcagaacctgctccgagaccagaccaccaacctcaaccagcagtct
cagaggtcgacccacacactgcagtctcctcagggtgctctgcctgcatctctatataat
accatgatgatctctcagccgacacaggccaatgtggtccagatctccacaagcctggcc
caaaacagcagcaccagcggagccgccgtcgaccttctcaccaaggatccgacagattac
cggttccctgccacccaacagctcctcactaagctagtaacaggccctatggcatgtggt
gcagttatggttcccaccaccatgttcatggggcaggtggtgacggcgtttgcccctcag
cagggtcagcctcagactatcagcattgctcagcagccgtcagcgcagacagccgatcag
cagacccacacacaggcacagacacaggccgcagcaacagcccagcagcagggacagaac
caggctcagctcacacagcagcagacgcagttccttcaggccccacgtcttttacatagc
aaccagtctacccagctgatcctccaggcggcgtttcctcttcaacaacaaggcacattc
acaaccgcaacacaacaacagcagcaacttcaccaacaacagcagcaacttcagcagcag
caacaactccaacagcagcagcaacaacagcagcagcagcttcaacagcagcatcaacaa
caacaacaacagcttcaacagcagcatcaacaacagcagcagcaactggcagctcatcgc
tccgacagcatgacggagcgctccaaccctccgccacagtaa

DBGET integrated database retrieval system