KEGG   Danio rerio (zebrafish): 30207Help
Entry
30207             CDS       T01004                                 

Gene name
tyr, sandy, zgc:109705
Definition
(RefSeq) tyrosinase (EC:1.14.18.1)
  KO
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    30207 (tyr)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    30207 (tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    30207 (tyr)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     30207 (tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 534 aa AA seqDB search
MSLHLLLFFLQLFSSSLQQFPRVCTSPEVLQSKRCCPVWPGDGSVCGVQSGRGFCQDVLV
SDLPNGPQYPHSGVDDRERWPLVFYNQTCQCAGNYMGFDCGECKFGFFGANCAERRESVR
RNIFQLSTTERQRFISYLNLAKTTISPDYMIVTGTYAQMNNGSTPMFANISVYDLFVWMH
YYVSRDALLGGPGNVWADIDFAHESAAFLPWHRVYLLFWEHEIRKLTGDFNFTIPYWDWR
DAQDCQVCTDELMGARSSLNRSLISPSSVFSSWKVICSQPESYNLREALCDGSPEGPLLR
NPGDHDRIRVPRLPTSADVESVLRLTDYETGQMDRRANLSFRNALEGFANPETGLAVTGR
SLMHNSLHVFMNGSMSSVQGSANDPIFIIHHAFIDSIFEQWLRRHQPPRTHYPTANAPIG
HNDGYFMVPFIPLYRNGDYFLSTKALGYEYAYLQDPGQRFVQEFLTPYLEQAQQIWQWLV
AAGILGAAVAGIIASVFAVACRRQTRRRKLSYGERQPLLNSSEEEGSASYQTTL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccatctcctcctcttcttcctccagctcttcagctcgtctctccagcagttc
ccccgagtctgcacctccccagaagtcctccagtccaaacgctgctgtccagtctggccc
ggcgacggctctgtgtgcggcgtccagtcaggtcgagggttctgtcaggacgtcctggtg
tccgaccttcccaacgggccgcagtatcctcactcaggagtggacgatcgagagcgatgg
cctttagtgttttacaaccaaacctgccagtgcgccggaaactacatggggtttgattgc
ggcgaatgcaagttcggcttcttcggtgccaactgcgcagagagacgcgagtctgtgcgc
agaaatatattccagctgtccactaccgagaggcagaggttcatctcgtacctaaatctg
gccaaaaccaccataagccccgattatatgatcgtaacaggaacgtacgcgcagatgaac
aacggctccacgccaatgttcgccaacatcagtgtgtacgatttattcgtgtggatgcat
tattacgtgtcccgggacgctctgctcggtgggcctgggaatgtgtgggctgatattgat
tttgcgcatgagtcggcggcgtttctgccttggcatcgggtgtatctgctgttttgggag
catgagatccggaagctaacgggagactttaacttcaccatcccgtactgggactggcgg
gacgcgcaggactgtcaggtgtgcacggatgagctgatgggggcgcgcagcagcctcaac
cgcagcctgatcagcccctcctctgtgttctcatcctggaaggtgatctgttctcagcct
gaaagttacaacctccgcgaggctttgtgtgacgggtcgccggaggggcctttactgcgc
aatcccggggaccacgaccggatccgggtaccgcggctgcccacatccgccgatgtagag
tcggtgctgcggctgacggactacgagaccgggcagatggaccgacgggcaaacctgagc
ttcaggaacgcgctggaaggttttgctaatcctgagacgggtttggcagtgacgggtcgc
agtttgatgcataactctttacatgtattcatgaacggctccatgtcttcagtgcaggga
tctgccaacgaccccattttcatcatacatcatgcttttattgacagcatctttgagcag
tggttgaggagacaccagccgccccgcacacactaccccaccgccaacgcccccatcgga
cacaacgacggatacttcatggtgcccttcatccctctctacaggaacggagactatttt
ctctccacgaaagccctgggatatgaatatgcatatttacaggatccaggtcagcggttt
gtgcaggagttcctgacgccgtatctggagcaggcgcagcagatctggcagtggctggtg
gcggcaggtatcctgggcgctgcagtagcaggaataatcgcatcggttttcgcagtggcg
tgtcgcagacagacgaggagacggaagctgtcatatggagagagacagccgctcctgaac
agcagcgaagaagagggttcagcttcatatcaaaccacactgtga

DBGET integrated database retrieval system