KEGG   Danio rerio (zebrafish): 30207Help
Entry
30207             CDS       T01004                                 

Gene name
tyr, sandy, zgc:109705
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dre00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:dre00740]
Organismal Systems; Endocrine system; Melanogenesis [PATH:dre04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 535 aa AA seqDB search
MSLHLLLFFFLQLFSSSLQQFPRVCTSPEVLQSKRCCPVWPGDGSVCGVQSGRGFCQDIL
VSDLPNGPQYPHSGVDDRERWPLVFYNQTCQCAGNYMGFDCGECKFGFFGANCAERRESV
RRNIFQLSTTERQRFISYLNLAKTTISPDYMIVTGTYAQMNNGSTPMFANISVYDLFVWM
HYYVSRDALLGGPGNVWADIDFAHESAAFLPWHRVYLLFWEHEIRKLTGDFNFTIPYWDW
RDAQDCQVCTDELMGARSSLNRSLISPSSVFSSWKVICSQPESYNLREALCDGSPEGPLL
RNPGDHDRIRVPRLPTSADVESVLRLTDYETGQMDRRANLSFRNALEGFANPETGLAVTG
RSLMHNSLHVFMNGSMSSVQGSANDPIFIIHHAFIDSIFEQWLRRHQPPRTHYPTANAPI
GHNDGYFMVPFIPLYRNGDYFLSTKALGYEYAYLQDPGQRFVQEFLTPYLEQAQQIWQWL
VAAGILGAAVAGIIASVFAVACRRQTRRRKLSYGERQPLLNSSEEEGSASYQTTL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccatctcctcctcttcttcttcctccagctcttcagctcgtctctccagcag
ttcccccgagtctgcacctccccagaagtcctccagtccaaacgctgctgtccagtctgg
cccggcgacggctccgtgtgcggcgtccagtcaggtcgagggttctgtcaggacatcctg
gtgtccgaccttcccaacgggccgcagtatcctcactcaggagtggacgatcgagagcga
tggcctttagtgttttacaaccaaacctgccagtgcgccggaaactacatggggtttgat
tgcggcgaatgcaagttcggcttcttcggtgccaactgcgcagagagacgcgagtctgtg
cgcagaaatatattccagctgtccactaccgagaggcagaggttcatctcgtacctaaat
ctggccaaaaccaccataagccccgattatatgatcgtaacaggaacgtacgcgcagatg
aacaatggctccacgccaatgttcgccaacatcagtgtgtacgatttattcgtgtggatg
cattattacgtgtcccgggacgctctcctcggtgggcctgggaatgtgtgggctgatatt
gattttgcgcatgagtcggcggcgtttctgccctggcatcgggtgtatctgctgttttgg
gagcatgagatccggaagctgacgggagactttaacttcaccatcccgtactgggactgg
cgggacgcgcaggactgtcaggtgtgcacggatgagctgatgggggcgcgcagcagcctc
aaccgcagcctgatcagcccctcctctgtgttctcatcctggaaggtgatctgttctcag
cctgaaagttacaacctccgcgaggctttgtgtgacgggtcgccggaggggcctttactg
cgcaatcccggggaccacgaccggatccgggtaccgcggctgcccacatccgccgatgta
gagtcggtgctgcggctgacggattacgagaccgggcagatggaccgacgggcaaacctg
agcttcaggaacgcgctggaaggttttgctaatcctgagacgggtttggcagtgacgggt
cgcagtttgatgcacaactctttacatgtattcatgaacggctccatgtcttcagtgcag
ggatctgccaacgaccccattttcatcatacatcatgcttttattgacagcatctttgag
cagtggttgaggagacaccagccgccccgcacacactaccccaccgccaacgcccccatc
ggacacaacgacggatacttcatggtgcccttcatccctctctacaggaacggagactat
tttctctccacgaaagccctgggatatgagtatgcatatttacaggatccaggtcagcgg
tttgtgcaggagttcctgacgccgtatctggagcaggcgcagcagatctggcagtggctg
gtggcggcaggtatcctgggcgctgcagtagcaggaataatcgcatcggttttcgcagtg
gcgtgtcgcagacagacgaggagacggaagctgtcatatggagagagacagccgctcctg
aacagcagtgaagaagagggttcagcttcatatcaaaccacactgtga

DBGET integrated database retrieval system