KEGG   Danio rerio (zebrafish): 30324Help
Entry
30324             CDS       T01004                                 

Gene name
tpma, TPM1, fb37a09, tm, wu:fb37a09
Definition
alpha-tropomyosin
Orthology
K10373  
tropomyosin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    30324 (tpma)
   04261 Adrenergic signaling in cardiomyocytes
    30324 (tpma)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   30324 (tpma)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
7
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAETDKKAAEERSKQLEDDLVALQKKLKATEDELDKY
SEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE
ERAELNEGKCSELEEELKTVTNNMKSLEAQAEKYSAKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccattaagaagaagatgcagatgctcaagctcgacaaggagaacgccttggac
agagcagagcaggctgagaccgacaagaaagcagctgaggagaggagcaagcagctcgag
gatgacctggtcgccctgcagaagaagctgaaggcaaccgaggatgagttggacaaatac
tccgaggccctgaaggatgcacaggagaaactggaactggctgagaagaaagctaccgat
gctgagggcgacgtcgcttccctgaacagacgcatccagctggttgaggaggagttggat
cgcgctcaggagcgtctggccactgctctgcagaagctggaggaggccgagaaggctgct
gatgagagtgagagaggcatgaaggtcattgagaacagggccctgaaggatgaggagaag
atggagctgcaggagatccagttgaaggaggccaagcacattgctgaggaggctgatcgc
aagtatgaggaggtggcccgtaagctggtgattgttgagggtgagctggagcgtactgag
gagcgcgctgagctcaatgagggtaagtgctctgagctggaggaggagttgaaaactgtg
accaacaacatgaagtctctggaggcccaggctgagaagtactcagctaaggaggacaaa
tatgaggaggagatcaaggtcttgactgacaagctgaaggaggctgagactcgtgctgag
ttcgctgagagatcagtcgccaagcttgagaagaccattgatgatctggaggatgaattg
tatgcccagaaactcaagtacaaagccatcagcgaggagctggaccacgctctcaacgac
atgacctccatttaa

DBGET integrated database retrieval system