KEGG   Danio rerio (zebrafish): 30354Help
Entry
30354             CDS       T01004                                 

Gene name
lpl, fb62e04, fc49b03, wu:fb62e04, wu:fc49b03
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    30354 (lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    30354 (lpl)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     30354 (lpl)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   30354 (lpl)
  Exosomal proteins of breast milk
   30354 (lpl)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Enzymes (General comment) Variety
  30354 (lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
22
AA seq 511 aa AA seqDB search
MMFNKGRVSSAFLISWMYFVYISSGLETTIDPTAESITLSDIIGNATEWMMDFTDIESKF
SFRTLEEPEDDLCYIVPGQPQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYE
REPSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLG
AHVAGIAGLLTKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSPDRSI
GIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVN
QDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYMKTREMMPYKVF
HYQVKVHFFGKTQLSYTDQPMKISLYGIHGEKENIPYIMPTLNTNSTVSFLLTTDADIGE
LLMVKLLWEKDTLISWPWWNSDTFHIRKLRIKSGETQSKIIFSAKESEFSYLSRGGEAAV
FVKDKEAQSSRKNQRLHKMKMHGSSFKQNNE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttaataaggggagagtaagcagcgcttttttaatatcttggatgtactttgtc
tacatttcctcgggattggaaactacaattgacccaactgctgaatctatcactttaagt
gacatcataggcaatgccacagaatggatgatggatttcactgacatcgagtccaagttt
tcttttcggaccctcgaagaacctgaagacgacctgtgctacatagttcctggtcaaccc
caatccatcaaagactgtaacttcaatacagaaaccaagactttcatagttattcatgga
tggacggtcacgggtatgtttgagagctgggttcccaaactggtaacagctctttatgaa
cgagagccctcagccaatgttattgttgtggactggttgtcccgtgcgcaacaacattac
ccaacatcagcctcctacacaaaactagttggcaaagacgtggccaaatttgtcaactgg
ttacaggctgaaattgattatccttgggagaagctgcatctgttgggttacagtcttggc
gctcatgttgcaggaatcgctggccttctcaccaaacataaagttaacagaatcacaggc
atggatcctgctggcccgacctttgagtatgcagattccctaagcactctttctccagac
gacgccaatttcgttgatgttcttcacaccaacacccgtggttctccagatcgtagcatt
gggattcaaaggccggtgggacacatagacatctaccccaatggtgggaccttccaacct
ggctgtgacctccagaacacgatgttaatggtggccactactggtttgagaaatatggat
cagatcgtgaagtgctctcacgagcgctctattcacctcttcattgactctctggtgaac
caggaccatgagagcatggcttttcgctgcagctccagagacagctttaacaagggcatg
tgcctcagctgccgcaagaaccgctgcaacaaggtgggatatgcagttaacaaaattcgc
acacgcaggagcagcaagatgtacatgaaaaccagagagatgatgccatataaagttttc
cattatcaagtgaaggtccacttctttggaaagacacaattaagctacactgaccagccc
atgaagatctcattgtatggaatacacggcgagaaggagaatattccctacattatgcct
actttgaacacaaacagcaccgtgtctttcctgttgaccacggatgcagacatcggagag
ctgctgatggttaaacttctctgggagaaagacacgctcatcagctggccttggtggaac
tccgacaccttccacattcgcaaactgcgcatcaagtctggagagacacagtcaaaaatc
atctttagtgcaaaagaaagtgaattttcctacctttcccgtggaggtgaggcggccgtc
ttcgtgaaagacaaagaggcccagtcgagccgcaaaaaccagagattgcacaagatgaag
atgcacggcagttcattcaaacagaacaacgagtaa

DBGET integrated database retrieval system