KEGG   Danio rerio (zebrafish): 30450Help
Entry
30450             CDS       T01004                                 

Gene name
cdc27, wu:fb54g06, wu:fc88c12
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    30450 (cdc27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    30450 (cdc27)
   04114 Oocyte meiosis
    30450 (cdc27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    30450 (cdc27)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     30450 (cdc27)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     30450 (cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 790 aa AA seqDB search
MTVLQEPVQAAVWHALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYHL
LKRHSCTTPQCKYLPAKCCVELSKLAEGEQILTGGVLNKQKSQDDIITEFGDSACFTLAL
LGQIYCKTDRIAKGAECYQKSMSENPFLWSPFESLCQIGERPDPEQIFRLTSLQNFSGGS
GGGIPPSPISPAHTPSNNMGHRQVDTVLMETPQETLEQNRLNLESSNSKYSLNMDSSVSY
IDSSVISPDSVPLSSSGSLLSKQVQNKPKSGRCLLGGTATLSPLTPSFGILPLEPSPGDP
AYLQSYGHSGTGMEPPPAPGPPKKAVSRIRTVGTKSVFAQSGNSREVIPNPFIQTQTTAP
QTSTTPQVLSQTIAAPPNVQPRRSSRLFTSASSTAKENSKKLKMKFPTKIPNRKTKTKTG
KGGITPSNLNESIEILKLDSSLSEGKGNILSQLPSHHYNTGWVLGQIGRAHFELAEYMQA
ERIFSEVRRIESYRVEGMDIYSTTLWHLQKDVALSALSKDLTDMDKNSPEPWCVVGNCFS
LQREHDIAIKFFTRAIQVDPSFAYAYTLLGHELVPTEELEKALGCFRNAIRLNKRHYNAW
YGLGMIYYKQEKFNLAEIHFKKAFSINPQSSVLLCHIGVVQHALKKSDHALETLNRAISI
DPKNPLCKFHRASILFANEKYKAALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALM
NFSWAMDLDPKGANNQIKEAIDKRYLPDDDEPVTPDDYPYCSTEVEESQESSMTDADDTQ
LHTTESDEVL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttgcaggaacctgtccaggctgctgtctggcatgctctgaaccactacgcc
taccgagatgctgtattcctggcagagaggctctatgctgaggtccattcagaagaggca
ctcttcctgctggccacgtgctactaccgttcagggaaagcatacaaggcctaccacctg
ctgaaaagacacagctgtactacaccacaatgcaaatatcttcctgccaaatgctgtgtg
gaactgagcaagttggcagaaggagaacagatcctgaccggaggagttttgaacaaacag
aaaagtcaagatgacatcataactgagtttggagactcggcctgcttcactctggcattg
ctcggacaaatttactgcaaaactgatcggatagcaaaaggagcagaatgttaccaaaag
agcatgagcgagaacccctttttatggtctccattcgagtcattatgtcaaatcggggag
cggccagacccggagcaaatcttcagattgacctccttgcagaattttagtggaggcagt
ggaggaggcatccctccctctcccattagccctgcgcacacacctagtaacaacatggga
cacagacaagtcgacactgtcctaatggagaccccacaggaaactttggagcaaaaccga
ctcaatctagaatcttctaactccaagtactctctgaatatggactcctctgtgtcatac
atcgactcctccgtcatttcgccagactctgtgccactgagcagtagtggttcactctta
tccaaacaggttcagaataaacccaaaagtggccgctgtctactggggggcacagccacg
ctcagtcccctcactccaagttttggaattttgcctctggagccgagcccaggagatcca
gcgtacctgcagagttatggtcacagtggaactgggatggagccacctcctgcgcctggc
cccccaaagaaggctgtcagtagaatcagaacagtggggacgaagtcagtgtttgcacaa
agtggcaacagcagagaggtcattccaaacccctttatccaaactcagactactgctcca
cagaccagtactacaccgcaagtgctgagccaaaccattgctgctcccccaaatgtgcag
ccacggcggagctcaagactcttcaccagtgccagctccactgccaaggagaacagtaag
aagctgaaaatgaagttccccaccaagattcctaaccgaaagaccaaaacgaaaacgggt
aagggaggaatcaccccatctaatctgaatgagagcatcgagatcctcaagttagattca
tccttatcagagggcaaaggcaacatcttgagtcagctaccttcacaccattacaacacg
ggctgggtgctgggtcagatcgggcgagcacactttgaactggctgaatacatgcaggcg
gagaggattttttcagaagtcagacgtatagagagctatcgagtagaaggtatggacatc
tactcaacaacactttggcatttacaaaaggatgtggcactttctgccctatctaaagac
ctcactgacatggacaaaaactcacctgagccctggtgtgtagttggtaactgtttcagc
ttacagcgagagcatgacatcgccattaagttcttcacacgggccatccaggtggacccc
agctttgcttacgcttatacactattagggcatgaactggttcccacagaggagctggag
aaagccctgggttgcttccgcaatgctatacgcctcaataaacgtcactacaatgcctgg
tatggcttgggaatgatttattataagcaggagaagtttaatctagccgagattcatttc
aagaaagcttttagcatcaatcctcagagctctgtgctactctgtcatatcggagtggtt
caacatgctttgaagaaatcagaccatgcactggagacccttaacagagccattagcatc
gaccctaagaatccgctatgcaaattccatagggcctcaattctgtttgccaatgaaaag
tacaaggcggctctgcaggagcttgaagagctgaaacaaatagtgcccaaagagtccctt
gtttacttcttaataggaaaggtctataagaagcttggccagactcatctggcattaatg
aacttttcctgggccatggacttggaccccaaaggggccaataatcagatcaaagaggcc
atagataagcgatacctcccagatgatgatgagcctgtcactcctgatgactatccctac
tgctcaacggaggtggaggaatcacaggagagcagtatgacggacgctgacgacactcag
ctccacacgacggaaagcgacgaggttctctag

DBGET integrated database retrieval system