KEGG   Danio rerio (zebrafish): 30450Help
Entry
30450             CDS       T01004                                 

Gene name
cdc27, wu:fb54g06, wu:fc88c12
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:dre04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:dre04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 790 aa AA seqDB search
MTVLQEPVQAAVWHALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYHL
LKRHSCTTPQCKYLPAKCCVELSKLAEGEQILTGGVLNKQKSQDDIITEFGDSACFTLAL
LGQIYCKTDRIAKGAECYQKSMSENPFLWSPFESLCQIGERPDPEQIFRLTSLQNFSGGS
GGGIPPSPISPAHTPSNNMGHRQVDTVLMETPQETLEQNRLNLESSNSKYSLNMDSSVSY
IDSSVISPDSVPLSSSGSLLSKQVQNKPKSGRCLLGGTATLSPLTPSFGILPLEPSPGDP
AYLQSYGHSGTGMEPPPAPGPPKKAVSRIRTVGTKSVFAQSGNSREVIPNPFIQTQTTAP
QTSTTPQVLSQTIAAPPNVQPRRSSRLFTSASSTAKENSKKLKMKFPTKIPNRKTKTKTG
KGGITPSNLNESIEILKLDSSLSEGKGNILSQLPSHHYNTGWVLGQIGRAHFELAEYMQA
ERIFSEVRRIESYRVEGMDIYSTTLWHLQKDVALSALSKDLTDMDKNSPEPWCVVGNCFS
LQREHDIAIKFFTRAIQVDPSFAYAYTLLGHELVPTEELEKALGCFRNAIRLNKRHYNAW
YGLGMIYYKQEKFNLAEIHFKKAFSINPQSSVLLCHIGVVQHALKKSDHALETLNRAISI
DPKNPLCKFHRASILFANEKYKAALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALM
NFSWAMDLDPKGANNQIKEAIDKRYLPDDDEPVTPDDYPYCSTEVEESQESSMTDADDTQ
LHTTESDEVL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttgcaggaacctgtccaggctgctgtctggcatgctctgaaccactacgcc
taccgagatgctgtattcctggcagagaggctctatgctgaggtccattcagaagaggca
ctcttcctgctggccacgtgctactaccgttcagggaaagcatacaaggcctaccacctg
ctgaaaagacacagctgtactacaccacaatgcaaatatcttcctgccaaatgctgtgtg
gaactgagcaagttggcagaaggagaacagatcctgaccggaggagttttgaacaaacag
aaaagtcaagatgacatcataactgagtttggagactcggcctgcttcactctggcattg
ctcggacaaatttactgcaaaactgatcggatagcaaaaggagcagaatgttaccaaaag
agcatgagcgagaacccctttttatggtctccattcgagtcattatgtcaaatcggggag
cggccagacccggagcaaatcttcagattgacctccttgcagaattttagtggaggcagt
ggaggaggcatccctccctctcccattagccctgcgcacacacctagtaacaacatggga
cacagacaagtcgacactgtcctaatggagaccccacaggaaactttggagcaaaaccga
ctcaatctagaatcttctaactccaagtactctctgaatatggactcctctgtgtcatac
atcgactcctccgtcatttcgccagactctgtgccactgagcagtagtggttcactctta
tccaaacaggttcagaataaacccaaaagtggccgctgtctactggggggcacagccacg
ctcagtcccctcactccaagttttggaattttgcctctggagccgagcccaggagatcca
gcgtacctgcagagttatggtcacagtggaactgggatggagccacctcctgcgcctggc
cccccaaagaaggctgtcagtagaatcagaacagtggggacgaagtcagtgtttgcacaa
agtggcaacagcagagaggtcattccaaacccctttatccaaactcagactactgctcca
cagaccagtactacaccgcaagtgctgagccaaaccattgctgctcccccaaatgtgcag
ccacggcggagctcaagactcttcaccagtgccagctccactgccaaggagaacagtaag
aagctgaaaatgaagttccccaccaagattcctaaccgaaagaccaaaacgaaaacgggt
aagggaggaatcaccccatctaatctgaatgagagcatcgagatcctcaagttagattca
tccttatcagagggcaaaggcaacatcttgagtcagctaccttcacaccattacaacacg
ggctgggtgctgggtcagatcgggcgagcacactttgaactggctgaatacatgcaggcg
gagaggattttttcagaagtcagacgtatagagagctatcgagtagaaggtatggacatc
tactcaacaacactttggcatttacaaaaggatgtggcactttctgccctatctaaagac
ctcactgacatggacaaaaactcacctgagccctggtgtgtagttggtaactgtttcagc
ttacagcgagagcatgacatcgccattaagttcttcacacgggccatccaggtggacccc
agctttgcttacgcttatacactattagggcatgaactggttcccacagaggagctggag
aaagccctgggttgcttccgcaatgctatacgcctcaataaacgtcactacaatgcctgg
tatggcttgggaatgatttattataagcaggagaagtttaatctagccgagattcatttc
aagaaagcttttagcatcaatcctcagagctctgtgctactctgtcatatcggagtggtt
caacatgctttgaagaaatcagaccatgcactggagacccttaacagagccattagcatc
gaccctaagaatccgctatgcaaattccatagggcctcaattctgtttgccaatgaaaag
tacaaggcggctctgcaggagcttgaagagctgaaacaaatagtgcccaaagagtccctt
gtttacttcttaataggaaaggtctataagaagcttggccagactcatctggcattaatg
aacttttcctgggccatggacttggaccccaaaggggccaataatcagatcaaagaggcc
atagataagcgatacctcccagatgatgatgagcctgtcactcctgatgactatccctac
tgctcaacggaggtggaggaatcacaggagagcagtatgacggacgctgacgacactcag
ctccacacgacggaaagcgacgaggttctctag

DBGET integrated database retrieval system