KEGG   Danio rerio (zebrafish): 30464Help
Entry
30464             CDS       T01004                                 

Gene name
rxrga, NR2B1, RXR, rxra, rxrg
Definition
retinoid x receptor, gamma a
Orthology
K08524  
retinoid X receptor alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    30464 (rxrga)
   03320 PPAR signaling pathway
    30464 (rxrga)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    30464 (rxrga)
Nuclear receptors [BR:dre03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   30464 (rxrga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
2
AA seq 441 aa AA seqDB search
MDNNDTYLHLSSSLQVAHGHLSSPPSQPPLSSMVSHHHPSIINGLGSPYSVITSSSLGSP
SASMPTTSNMGYGALNSPQMNSLNSVSSSEDIKPPPGLAGLGSYPCGSPGSLSKHICAIC
GDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDNKDCQIDKRQRNRCQYCRYQKCLAM
GMKREAVQEERQRGRERSDNEVDSSSSFNEEMPVEKILDAELAVEPKTEAYMESSMSNST
NDPVTNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSVTVK
DGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDAK
GLSNPSEVEALREKVYASLEGYTKHNYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKL
IGDTPIDTFLMEMLEAPHQIT
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggataataacgacacatatctccatctcagttcttcgttgcaggtagcacatggtcac
ctgagttctcctccgtcccagcctcctctgagctccatggtgtcgcaccatcacccatcc
atcatcaacggtctggggtctccatactcagtcatcacctcctcctctctgggctcgcct
tcggcctctatgcccaccacttccaacatgggctatggagcactcaacagtccacagatg
aactctctgaacagtgttagcagctcagaggacattaaacctcctccaggactggcagga
ctgggcagttacccttgcggcagccccgggtccctctccaaacacatctgtgccatttgt
ggagaccgatcctcagggaaacattatggtgtttacagctgtgaaggatgcaaaggcttc
ttcaagagaaccatccggaaagacctgacgtacacttgtcgagacaataaggactgccag
atagacaaacgccagcgaaaccgctgccagtactgtcgctatcagaagtgtctcgccatg
ggcatgaagagagaggcggtccaggaggagaggcagcgcggtcgggagaggagtgataat
gaagtggactccagcagcagcttcaatgaagagatgccggtggagaagatcctggacgct
gagctggcagtggagcccaagacagaagcttacatggagtcaagcatgagcaactctaca
aatgacccagtgaccaacatctgccaggctgcagataagcagcttttcacgcttgttgaa
tgggcgaagaggatcccacacttctctgacctccctctagatgatcaggtcatcttgctg
cgagcaggttggaacgagctgcttattgcttcattctcacatcgctcagtgacagttaaa
gatgggatcctcttggccaccggcctgcatgtccatcgcagcagtgctcacagcgccggt
gtgggctctatatttgacagggtattaacagagctggtgtctaagatgagggacatgcag
atggacaagacggagctgggctgtttaagagcaatcgtcctcttcaacccagatgcaaaa
ggactatcaaacccatcagaggtggaggcgttaagggaaaaagtgtacgcatcgctggag
ggctacaccaaacacaactacccggatcagcctggaaggtttgccaagctactcctgcgt
ctcccagctctgcgctccattggactgaagtgtctggagcatctgttcttcttcaagctc
attggagacacacctatagacactttcctcatggagatgctggaagcaccgcatcaaatt
acatga

  All links  
No link information was found.   
DBGET integrated database retrieval system