KEGG   Danio rerio (zebrafish): 30505Help
Entry
30505             CDS       T01004                                 

Gene name
dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    30505 (dbh)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     30505 (dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 614 aa AA seqDB search
MRLINKDLRLQDVTLMYLTVLATVVVLLVASYQAPAGQSRPTLAYHIPLDPSGQLELSWN
ISYPKQEVLLEVKVKELHHGIILGMSDRGEPTNADLVILWDDGHKSYFGDAWSDSEGRVT
LDTQQDYQLLETHQSTEGFFLLFKRSFSTCDPHDYIIEEGTVHIIYTMLEHPILSLHELN
ISRLQPGVQRVLLLRPDTPSPHLPKDVRTLEVLAPDVIIPTQETTYWCHIYQLPPNLPKN
HIVMYESVITPGNEAIVHHIEVFECSPQMDIVPQYSGSCDSKMKPRNLNYCRHVLAAWAM
GAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLLSGRRDSSGIRLWYSPSLRRFDAGI
MELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGLGVRTVL
VRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIM
EEMCVNYVHYYPRTQLELCKSHVDTDYLQKYFSLINRFQGRESCSCPQTSVEEQFSSVSW
DSFSGEVLNSLYVTAPFSMHCNQSTAQLFPGDWEKQEIPVVTAQLQRAPYPCEINRRVAS
NNDSPTEVRADSSG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcataaacaaagacctccggctccaagacgtaaccctgatgtacctcaccgtt
ttagccactgtggtggtgcttttagtggcatcctaccaggctcctgcgggccaatccaga
cccaccctggcctatcatatcccgctggatccgtcaggacagctggaactgtcctggaac
atcagttatcccaagcaggaggttttgctcgaggtcaaagtcaaagagctccatcatggc
attattctgggcatgtctgatcgtggagagcctacgaatgctgatttggtgattctgtgg
gatgacggtcacaaatcctattttggggatgcgtggagtgacagtgaaggcagagtgaca
ctggacactcaacaggactatcagctgctggaaacccatcagtccactgaaggcttcttt
ctgctcttcaaaagatcattcagcacctgtgacccacacgactacatcatagaggaaggc
actgtccacataatctacaccatgctggagcatcccatcctatcgttgcatgagctcaat
atatcccgtctccagcctggcgtccagcgagtcctgctcctgcgtccagacaccccgtcc
ccccatctcccgaaagatgtacgcaccctggaggtcctggcccctgatgtcatcatcccc
acacaagagactacttactggtgccatatctatcagctcccgccaaatctgcccaagaac
cacattgtcatgtatgagtcagtgatcactccaggtaatgaagccattgttcatcacatt
gaagtgttcgaatgctcccctcagatggacatcgtaccacagtacagcggctcctgtgat
tcaaagatgaagccgcgcaatcttaattattgcagacatgttctggctgcctgggccatg
ggagcagagccattctactatcctgctgacgctggtttgcctatgggaggagaaggatct
tctaggtttcttcgtcttgaagttcattaccacaaccctctccttttatcagggcggagg
gactcctcgggcattcgtttatggtacagtccatctctgcggaggtttgacgcaggcatc
atggagcttgggctggtctacactcctgtgatggccattcccccccgccagcgctctttc
cagctcactggatactgcaccgccaaatgcacacagacggctcttccagtagggggcata
cacatctttgcctcccagctgcacactcatctggccggtcttggggtcaggactgtcttg
gtgcgaggaggtcaagaggtggaggtggtgcaggaggacaaacatttcagcacacattac
cagatcatccgtgttttacagaagatggtgactgttctgccaggcgatgctctgctcacg
acgtgcagattcaacaccgaggacagaagcaaagttactgtgggtggttttggaattatg
gaggagatgtgcgtcaattacgtccattattacccccgaacgcaacttgagctgtgcaaa
agccacgtggacacagattacctgcagaaatacttcagcctcatcaacaggtttcagggc
cgcgagagctgcagttgtcctcagacctctgtggaagaacagttctcctcagtgtcctgg
gacagtttcagtggagaggtgctgaactcgctctacgtcacagcaccattttcaatgcac
tgcaaccagtccacagcgcagctctttcctggtgactgggagaagcaggagatcccggtg
gtgacagcgcagcttcagagagccccatacccatgtgaaataaacaggagagtggcttct
aataatgacagccctacagaggtgcgagcggacagcagcggctga

DBGET integrated database retrieval system