KEGG   Danio rerio (zebrafish): 30592Help
Entry
30592             CDS       T01004                                 

Gene name
myl7, cmlc2, mylc2a, zgc:92755
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    30592 (myl7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    30592 (myl7)
   04530 Tight junction
    30592 (myl7)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     30592 (myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 172 aa AA seqDB search
MASKKAAAKRGKTAQRGSSNVFSMFEQSQIQEFKEAFGCIDQNRDGVINKSDLKETYAQL
GKLNVSDEELESMLTEGKGPINFTVFLTLFGEKLNGTDPEETILAAFKLFDPNATGVVNK
DEFKRLLMTQADKFTAEEVDQAFAVAPIDVAGNIDYKSLCYIITHGDEKEES
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctagtaaaaaagccgcggccaagagggggaaaactgctcaaagaggctcttccaat
gtcttctccatgtttgagcaatcacaaatacaggagtttaaggaggcttttggctgcata
gatcagaaccgggatggagttatcaacaaatctgatctgaaggaaacttatgcacaacta
gggaagctgaatgtgagtgatgaagagctggagtccatgctaacagaaggaaaagggccc
ataaacttcactgtcttcctcaccctctttggagagaagcttaatggcacagacccagag
gaaaccatccttgctgcttttaaattgttcgaccctaatgccacaggagttgtcaataaa
gatgagttcaagaggctgctaatgacccaagctgataaattcacagcagaagaggttgac
caggcttttgcagtggctccaatagacgtggctggaaatattgattataagtcgctttgt
tacattatcacacatggtgatgaaaaagaggaatcttga

DBGET integrated database retrieval system