KEGG   Danio rerio (zebrafish): 30592Help
Entry
30592             CDS       T01004                                 

Gene name
myl7, cmlc2, mylc2a, zgc:92755
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    30592 (myl7)
  Cellular commiunity
   04510 Focal adhesion
    30592 (myl7)
   04530 Tight junction
    30592 (myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 172 aa AA seqDB search
MASKKAAAKRGKTAQRGSSNVFSMFEQSQIQEFKEAFGCIDQNRDGVINKSDLKETYAQL
GKLNVSDEELESMLTEGKGPINFTVFLTLFGEKLNGTDPEETILAAFKLFDPNATGVVNK
DEFKRLLMTQADKFTAEEVDQAFAVAPIDVAGNIDYKSLCYIITHGDEKEES
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctagtaaaaaagccgcggccaagagggggaaaactgctcaaagaggctcttccaat
gtcttctccatgtttgagcaatcacaaatacaggagtttaaggaggcttttggctgcata
gatcagaaccgggatggagttatcaacaaatctgatctgaaggaaacttatgcacaacta
gggaagctgaatgtgagtgatgaagagctggagtccatgctaacagaaggaaaagggccc
ataaacttcactgtcttcctcaccctctttggagagaagcttaatggcacagacccagag
gaaaccatccttgctgcttttaaattgttcgaccctaatgccacaggagttgtcaataaa
gatgagttcaagaggctgctaatgacccaagctgataaattcacagcagaagaggttgac
caggcttttgcagtggctccaatagacgtggctggaaatattgattataagtcgctttgt
tacattatcacacatggtgatgaaaaagaggaatcttga

DBGET integrated database retrieval system