KEGG   Danio rerio (zebrafish): 30681Help
Entry
30681             CDS       T01004                                 

Gene name
mapk12a
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    30681 (mapk12a)
   04370 VEGF signaling pathway
    30681 (mapk12a)
   04068 FoxO signaling pathway
    30681 (mapk12a)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    30681 (mapk12a)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    30681 (mapk12a)
   04621 NOD-like receptor signaling pathway
    30681 (mapk12a)
   04622 RIG-I-like receptor signaling pathway
    30681 (mapk12a)
  Endocrine system
   04912 GnRH signaling pathway
    30681 (mapk12a)
   04914 Progesterone-mediated oocyte maturation
    30681 (mapk12a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    30681 (mapk12a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    30681 (mapk12a)
  Infectious diseases
   05132 Salmonella infection
    30681 (mapk12a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     30681 (mapk12a)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   30681 (mapk12a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 363 aa AA seqDB search
MTARSRPGYFRQEINKTIWEVPDRYKDLKQVGTGAYGTVCYALDRRTGAKVAIKKLHRPF
QSDLFAKRAYRELRLLKHMKHDNVIGLVDVFTADLSLDRFHNFYLVMPFMGTDLGKLMKM
ERLSEERVQYLVYQMLKGLKYIHAAGIIHRDLKPGNLAINEECELKILDFGLARQTDSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLLGKPLFKGHDHLDQLMEIMKVT
GTPSKEFTAKLQSEDARNYVTKLPRFRKKDLRILLPNVNPQAIKVLEGMLLLDPESRITA
AEALAFPFFSEFREPEEETEAPPYDHSLDEADQSLEQWKRLTFTEILTFQPAPAVAESKE
TAL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccgatcgagacctggctattttcgacaggagataaataaaacaatctgggag
gtgccggatagatacaaagatctgaaacaggtggggacgggggcatatggtacagtatgc
tatgcattagaccggaggacaggggcaaaggtggccatcaagaaactccatcgtcccttc
cagtctgacctgtttgccaaaagagcctatcgtgagctcaggctgctcaaacacatgaag
catgacaatgttatcggactcgtggatgtgttcactgcagacctttccctagacagattc
cacaacttttacttggtcatgcctttcatgggtactgatctgggaaagttaatgaaaatg
gagagactttcagaagagagagtgcagtatctggtctatcagatgttaaaaggcctcaaa
tatatccatgccgctggaatcattcacagggatctcaaaccaggcaatcttgcaataaac
gaggagtgtgagcttaagatcctggattttggcctggctcggcaaacagacagtgaaatg
acgggctacgttgtgacacgctggtacagagcgcctgaggtcattctgagctggatgcat
tacacacagactgtggacatctggtcagtcggatgcatcatggcagagatgctgctagga
aaaccactattcaaaggacacgaccacctggatcagctgatggagatcatgaaggttaca
gggacaccctcaaaagagttcacagcgaagctacagtctgaagatgctagaaactacgtc
acaaagttaccaagatttagaaagaaagatctgcggattctattaccaaatgttaacccg
caagcgattaaagtgttagaaggcatgctgcttttggaccctgagagccggataacagca
gcagaggcactggcttttcctttcttctcagagtttcgtgaaccagaggaggaaaccgag
gctccaccatatgaccattcgctggatgaggctgatcagtcgctagagcaatggaaaaga
ctcacttttacagaaattctgaccttccagccggctcctgcggtggctgaatctaaagag
acggccctctga

DBGET integrated database retrieval system