KEGG   Danio rerio (zebrafish): 30681Help
Entry
30681             CDS       T01004                                 

Gene name
mapk12a, erk6, etID309866.18, mapk12, sapk3, wu:fa05c12, zgc:101695
Definition
mitogen-activated protein kinase 12a (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:dre04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:dre04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:dre04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
18
AA seq 363 aa AA seqDB search
MTARSRPGYFRQEINKTIWEVPDRYKDLKQVGTGAYGTVCYALDRRTGAKVAIKKLHRPF
QSDLFAKRAYRELRLLKHMKHDNVIGLVDVFTADLSLDRFHNFYLVMPFMGTDLGKLMKM
ERLSEERVQYLVYQMLKGLKYIHAAGIIHRDLKPGNLAINEECELKILDFGLARQTDSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLLGKPLFKGHDHLDQLMEIMKVT
GTPSKEFTAKLQSEDARNYVTKLPRFRKKDLRILLPNVNPQAIKVLEGMLLLDPESRITA
AEALAFPFFSEFREPEEETEAPPYDHSLDEADQSLEQWKRLTFTEILTFQPAPAVAESKE
TAL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccgatcgagacctggctattttcgacaggagataaataaaacaatctgggag
gtgccggatagatacaaagatctgaaacaggtggggacgggggcatatggtacagtatgc
tatgcattagaccggaggacaggggcaaaggtggccatcaagaaactccatcgtcccttc
cagtctgacctgtttgccaaaagagcctatcgtgagctcaggctgctcaaacacatgaag
catgacaatgttatcggactcgtggatgtgttcactgcagacctttccctagacagattc
cacaacttttacttggtcatgcctttcatgggtactgatctgggaaagttaatgaaaatg
gagagactttcagaagagagagtgcagtatctggtctatcagatgttaaaaggcctcaaa
tatatccatgccgctggaatcattcacagggatctcaaaccaggcaatcttgcaataaac
gaggagtgtgagcttaagatcctggattttggcctggctcggcaaacagacagtgaaatg
acgggctacgttgtgacacgctggtacagagcgcctgaggtcattctgagctggatgcat
tacacacagactgtggacatctggtcagtcggatgcatcatggcagagatgctgctagga
aaaccactattcaaaggacacgaccacctggatcagctgatggagatcatgaaggttaca
gggacaccctcaaaagagttcacagcgaagctacagtctgaagatgctagaaactacgtc
acaaagttaccaagatttagaaagaaagatctgcggattctattaccaaatgttaacccg
caagcgattaaagtgttagaaggcatgctgcttttggaccctgagagccggataacagca
gcagaggcactggcttttcctttcttctcagagtttcgtgaaccagaggaggaaaccgag
gctccaccatatgaccattcgctggatgaggctgatcagtcgctagagcaatggaaaaga
ctcacttttacagaaattctgaccttccagccggctcctgcggtggctgaatctaaagag
acggccctctga

DBGET integrated database retrieval system