KEGG   Danio rerio (zebrafish): 317763Help
Entry
317763            CDS       T01004                                 

Gene name
ttk, mps1, ncp
Definition
ttk protein kinase (EC:2.7.12.1)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    317763 (ttk)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     317763 (ttk)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Other group
  TTK family
   317763 (ttk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 983 aa AA seqDB search
MDEEESTERQMQIAMLCQKLAMMKQLFNEDDTDYINQAISSNSPDTCRTFLSNLEKKGNP
QADPSLLSKLMDSYTRVFSSMPLGKYSQNESYAKMLVRFAELKAIQDVNDAQTSFDIARS
HCKDFAFVHVAYAQFELLQGNMKKCTMILQKAFEMNAKPRHVLEAAVRNLKTGKRQLLSH
EDKENLSVSALDHTQGSRRSDGTCELKPSSTFLHSSDQKFSPQEENGPVWRTGSQHRRTA
MAERVPMVPLSIPENETSDSDCAQKAEAPFTHSSGFSRQTSGSSVRSAFSLCSSKKGTPD
GDSYSLNIKPPVISPDYLREDIEEGHTITALLNRAEKRETARTEETTDINQIISTNSTEG
CQAFLKNLEKRADPHSDAAFLSKLLDCYSKVFARFPLAEHCKTESYARMLVRYAELKGIE
DPEDAADDFSIARSHCKAFAFVHIAHAQFELSRGNSRKSVSILQKALSSNARPIELLQTA
IRNLKSGKTLLLPADLQESSEAENVEAQNYIKREENSAKAPEDHQKPFSKETSSEWKIPA
LITKHTSPEDRKASLEPVSSSSSHHAVRTPAPLRLNPSLSCQTPNYRQPNPNSFVTPVVK
QRPVIVSVPATAQKMCPTALPCTPQSGVSYIQPPTQTPSSAFSNESITIKGKQFFIFKMI
GRGGSSKVYQVFDHKKHVYAVKYVNLEEADAQAVESYKNEIEHLNHLQQYSDQIIKLYDY
EITSSYIYMLMECGHLDLNTWLRNRKTVKPLDRKAYWRNMLEAVHTIHKHGIVHSDLKPA
NFLIVDGSLKLIDFGIANQIQPDVTSIMKDSQVGTLNYMPPEAIKDTSSNGKPGSKISAK
GDVWSLGCILYCMTYGKTPFQNITNQISKIHAIIDPSHEIDFPDIPEKDLLDVLKKCLVR
NPRERISIAELLDHPYLQLQPQPAPEPAETSSSDFKRILNELVALQSPNSIARAASNLAM
MCNSGRKLDVSECVKSSSQTLWK
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaagagagcacagagcgacagatgcagattgccatgctgtgtcaaaagctg
gccatgatgaagcaattgttcaatgaagatgacacggattacataaaccaggccattagc
tcaaactccccggacacctgccggacatttctgagcaatctggagaagaaaggcaatcct
caagcagaccccagcctgctcagcaaacttatggacagctacacgcgggtcttttccagt
atgccattgggcaagtacagtcagaacgagagctacgccaagatgctggtcagatttgca
gagttaaaagccatccaggatgtaaatgatgcacagactagtttcgatatagcgaggtcc
cactgtaaagattttgctttcgttcacgtcgcttatgctcagtttgagcttttgcaaggc
aacatgaagaaatgcactatgattcttcagaaggcatttgaaatgaatgctaaacccaga
cacgttctggaggctgcagtgcgcaatctgaagaccggcaaacgccagcttctatcgcat
gaagataaggagaacctatcagtatctgcactggaccacacacaaggctccagaagatca
gatgggacgtgtgaactgaagcccagcagcacttttctccacagcagtgatcagaagttc
agtcctcaagaggagaacgggcccgtgtggagaacaggatcccagcacagaagaacagcc
atggcggaaagagttcccatggtgcctctgtctatccctgaaaatgagaccagtgactct
gactgtgctcagaaagcagaagctccttttacccacagcagcggtttctccagacaaaca
agcggttcaagtgtccgctctgcattttcgttatgctcctcaaagaagggcactccagat
ggagattcctacagcttaaacataaagccacctgttatcagtccggattatcttcgtgaa
gacattgaagagggtcacaccatcacagcacttctaaacagagcagaaaaaagagaaacg
gccagaacagaagaaaccactgacatcaaccagatcatcagcacaaactcgactgaaggt
tgccaggccttcctgaaaaaccttgagaagagagcagaccctcattcagacgcagcattt
ctctccaaactcctggactgctactccaaagtgttcgccaggtttcctttggcagaacat
tgcaaaactgaaagctatgctcgaatgctggttcgatatgcagagctgaaaggaattgaa
gatccagaagatgctgcagatgatttcagtattgccaggtcacactgtaaagcttttgct
tttgtgcacatcgcacatgctcagtttgagctctcacgaggtaattctaggaagagtgtt
tcgattcttcagaaagcgctgagctccaacgctcgaccaattgaactgctgcaaactgcc
atcaggaaccttaaatctgggaaaactcttctgcttcctgctgaccttcaggaaagctct
gaagctgaaaatgtggaagcacaaaattacataaagagagaagaaaattcagcgaaggct
cccgaggatcatcagaaacctttttccaaggagacttcatcagaatggaagattcctgct
ctcattaccaaacacacgtctccagaggatcggaaagcttctttagagcccgtttcctct
tcatcttcccatcatgcagtgcgaacgcctgcacctcttcgattaaacccctcactcagc
tgtcagacgcccaactacagacagccaaatcctaacagttttgtgactcctgtggtgaag
cagcggcctgtgattgtgtctgttccagcgacggctcagaaaatgtgtccgactgcgctg
ccctgcacgcctcagagcggtgtgtcctacatccagcctcccacgcagactccttcttca
gccttctcaaatgaatccataacaattaagggcaagcagttcttcattttcaagatgatc
ggcagaggaggatccagtaaggtatatcaggtctttgaccataagaagcacgtgtacgct
gtcaaatatgtgaatctggaggaggccgatgctcaggcggtggaaagctacaagaatgag
atcgagcacttgaatcatcttcagcagtacagcgaccagatcatcaagctctatgactat
gagatcaccagcagctacatctacatgctgatggagtgcggacacctggatctgaacacc
tggctgcgcaaccgcaagaccgtcaaaccgctggacaggaaggcttactggaggaacatg
ctggaggctgtgcacaccatccacaaacacggcatcgtccacagtgacttaaagccagcc
aattttttgatagtggatggttcgctgaagctaatagactttggaatcgccaaccagatt
cagcctgacgtgaccagcatcatgaaggactcgcaggtcggaactctgaactacatgcca
ccggaggccattaaagacacgtcctccaatggaaagccggggtcaaagatcagtgctaaa
ggggacgtgtggtctctgggctgcatcctgtattgcatgacatacggcaagactccattc
cagaacatcaccaatcagatcagcaaaatccacgccattatcgacccgtcccacgagatc
gacttccctgacattcccgaaaaagacctgctggatgtgctgaagaaatgtttagttcgc
aaccctcgagaaaggatttccattgcagagctgctcgatcatccatacctgcagctacag
ccacaacctgcacctgagccagcagaaacgtcctccagtgattttaagaggatcctcaat
gaactggtggctcttcagtctccaaacagtatcgctagagctgccagcaatttagccatg
atgtgcaacagcgggaggaaactggatgtttctgaatgtgtgaaaagctccagtcagacg
ctgtggaaatga

DBGET integrated database retrieval system