KEGG   Danio rerio (zebrafish): 321193Help
Entry
321193            CDS       T01004                                 

Gene name
paics, cb293, sb:cb293, wu:fa28a05
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (EC:4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    321193 (paics)
Enzymes [BR:dre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     321193 (paics)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     321193 (paics)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 425 aa AA seqDB search
MSTATELKLGQKLNEGKTKQIFEILDEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKT
TSCVFKLLQDAGLKTAFVRQHSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYR
FTPLKMEMFFKDDANNDPQWSEEQLLAAGFDLAGLTIGRCEVDIMSKSTVAIFEVLEKAW
ATQDCTLVDMKIEFGVNVTTKEIVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPE
AMQMVKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVN
SAHKGPDETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQ
DIWSSLRMPSGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASMLNTWVSLKQADKKM
QDCSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgcaacagaactaaaactaggtcaaaagctgaatgaggggaagaccaagcag
atctttgagattttggatgagccgggtcatgtcctggtccagtctaaagatcagatcacc
gcgggcaatgcggttcggaaggatcagatggagggcaaagctgctattgccaacaagacc
accagctgtgtgtttaaacttttacaagatgctgggcttaagaccgcatttgtcaggcag
cattctgacactgcatttgtggcatctcgatgtgaaatgatacccattgaatgggtctgc
agacgtatcgccacgggttccttcctcaaacgcaaccctggggttaaagagggctaccgc
ttcactcctttaaaaatggagatgttttttaaggatgatgccaataatgaccctcaatgg
tcagaagagcagctgttggcagctggttttgacctggctggactgactattggtcgctgt
gaggtggacatcatgagcaaaagcactgtggccatttttgaagtcctggagaaggcttgg
gccacccaggactgcacgctggtggatatgaaaatagaatttggagtaaatgtgaccact
aaggagattgtgctggctgatgtgattgacaatgactcatggaggctctggccagctggg
gatcgcagccagcagaaagacaaacaggtgtaccgtgacctgaaagaagtcactcccgag
gccatgcagatggtaaagaggaacttcgagtgggtcgcagagcgagttaagctgctcctg
gagtcccaggcgagaggaagggtggtagttatgatgggctccacctcagatgtggctcac
tgtgagaagatccgtaaagcttgtgcttcatatggcattccctgccacctcagagtcaac
tctgcccataaaggccctgatgagacactccgcatcaaagctgaatatgagggcgatgga
gaacctactatctttgttgcagtggcaggcagaagtaacggcttgggtcctgtgatgtca
ggaaacactgcttatccagtcattaactgtccccctgtaacccctgactggggagctcag
gacatctggtcgtctcttcgcatgcctagtggtctgggctgctccactgttctttctcct
gaagctgctgctcagtttgcagcgcagatcctgggtctaaacaaccatttgatttgggcc
aaacttcgtgcatccatgctgaacacctgggtctccctgaaacaggctgataaaaagatg
caagactgcagcctttaa

DBGET integrated database retrieval system