KEGG   Danio rerio (zebrafish): 321283Help
Entry
321283            CDS       T01004                                 

Gene name
tacc3, cb500, sb:cb500, wu:fd20f10, zgc:111850
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dre03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 942 aa AA seqDB search
MSSDALKENQGAVRMNSNSEFACDIFMLDQPTGRPSILRQSQADNINRTAPRAAKVCFQT
PRRDPVTKKIMSPSRTSRPISQDDHKNALETLTGLSDQSSLMNNTHTTPIDIECNSVALP
DDDMPVQSRGAYSFDLDNIDAINPFQGSNKMANSPPKSSAFTEAATSELVESNTTIAPVS
APQVEVETEAEVTDSAFEEAVPSVENSLAECSANISSTEGNVAPVLAPQAEVPEVTESAL
DETLPFVPSVENSLAECSANLSSAEGTVILKTENIENSTNETEETEITDPVAEPQQIPVF
EGQPEAQDLPLPSAGSYKLDFDNLEMLNPFQTGGSKIPNSPPTKTSTVFDPPLLSHEPEQ
ELSVQTDIPTSSDPSITPQENSTATESSSSTTAPKESQMLLEFNFDDGAEVKRKPPPKRL
GVKRTVGAKPVPKKTDALVTEKKDAEPKQMSPTSPEETQPVDIPSAKGSYTFDFEQFDNP
NFNPFGTKAMMGNSPPRGVQTSPVLKKAQSPVKQLETLPAQDDQPEQRSPQVVSESKENM
VEANLPETKELAEDVESSMAVPHTDKPQNPAVPEPDFMAVPESIADIQNQTCDLGVAASN
EDEFVPGALFMPGGDFDGQIDYLEQFGSSNFKESALRKQSLYLKFDPLLKESPKKNGGEG
SNFGFCMPRPSLAIRMMEAAKSEVKQKSQCDSVKLLDDLPPLAVETVVPDPTVLDLLVPA
LKPPVRTEDSIIEVLKYSQKDMDAALQKADRQSEERQQELKSQIEKLQLENQQMLFIMSE
FETTITQITDEHKQKEALAKMEMERVLEEKDQLAKDLNELERSFSSVVKRLDRCKEVIEG
FKKNEETLKQYAKNCMDRLQKEEKRYQALKAHAEEKLEQANKAIAEVRTKQGAEVAALQV
QLKREQLKVQSLEKDLEQKAKEVKDVTELCDELLLKVQKHGF
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgacgcgctgaaggagaatcagggagctgtacggatgaacagcaattctgaa
ttcgcttgtgacattttcatgttggatcagccgactggcagaccctcgattttgcggcag
tcgcaggctgacaacattaacaggactgctcctagagcagcaaaggtttgttttcaaacc
ccacggcgagatccagtgacaaagaagatcatgtctccaagccgcaccagtaggccgatc
agccaggatgatcacaaaaatgcactagagactctcacaggcctttctgaccagagttca
ttgatgaataacactcacaccacaccaattgacatagaatgtaacagtgttgctttacct
gatgatgacatgcctgttcagagcagaggggcctattcctttgatcttgacaatattgat
gccatcaaccctttccagggctccaataaaatggcgaattccccacctaaatcttctgct
tttacggaggcggcaacatcagagcttgtagagtctaacacaaccatagcccctgtttct
gcaccccaggtagaggtagagacagaggcagaagtgactgacagtgcatttgaagaagct
gtcccatcagtggagaattcccttgcagaatgctctgccaacatctcatcgacagagggc
aacgtagcccctgttcttgcacctcaggctgaagttccagaggtgactgaaagtgcactt
gatgagactctcccatttgtgccatcagtggagaattcccttgcagaatgctcggccaac
ctctcttcagcagagggcacagtcatcctcaagactgagaatattgaaaacagcaccaat
gaaacagaggagactgagatcactgacccagtggcagagccacagcagattcctgttttt
gagggtcaacccgaggcacaggacttgccactaccttctgcaggatcttacaagttggat
tttgacaaccttgaaatgctcaacccattccaaactggtgggtcaaagatccccaactct
cctccaaccaaaacatcaacagtttttgacccacccctgctaagccacgaacctgaacaa
gagctatcagtccagacagatatcccaacatcctccgatccatccataacacctcaggag
aactccactgccacagagagttcctcatctacaactgccccaaaggagagccagatgcta
ttagagtttaattttgatgatggagctgaagttaaacgcaaacctcctccaaaacgcctt
ggggtcaaaagaactgttggtgcaaaacctgtgcccaaaaaaacagatgcactagtcaca
gagaaaaaagatgcagaacccaagcagatgtctcctacaagcccagaggagacccaacct
gtggatattccttctgctaaaggttcttacacttttgattttgaacaatttgataaccca
aactttaacccctttggcacaaaggctatgatgggaaactcaccaccacgtggggtccag
accagtccagttttgaagaaagcacaatctcctgttaagcaacttgagacacttcctgcg
caggatgaccaacctgagcaacgatctccccaggtagtttctgaaagcaaggaaaatatg
gtagaagcgaatcttcctgagactaaagagctggcagaagatgttgagtcatcaatggct
gtacctcacactgacaaaccccagaatccagcggtgccggaaccagatttcatggcagta
ccagaatctattgcagatattcaaaatcagacctgtgatcttggtgtggcagcatcaaat
gaagatgaatttgtgcctggtgctttgttcatgccaggaggagattttgatggacagatt
gactatctggagcagtttggatcgagcaatttcaaagagtctgccttgaggaagcagtcc
ctgtatttgaagtttgacccgctgttaaaggagagtccaaagaaaaatggaggggagggc
agtaattttggattctgcatgccaagaccctctcttgccatcaggatgatggaggctgca
aagtctgaagtgaagcagaagtctcaatgtgacagcgtgaaactgttggatgatctgcct
ccactagctgtggaaactgtggtgccagatccaactgttttagacctgctcgttcctgcc
ttgaaaccgccagtgaggactgaggactccatcatagaggttctgaagtacagtcagaaa
gacatggacgccgcactacagaaagcagacagacagtccgaggaacggcaacaagagctg
aagtctcagattgagaaattgcaactagagaatcagcagatgttgtttataatgtcagaa
tttgagaccaccatcactcaaatcaccgatgagcacaaacagaaagaagcattggctaaa
atggagatggagagagttcttgaggaaaaagatcagctggccaaagatttgaatgagttg
gagcgatcgttctcctcagtcgtcaaacgtcttgacagatgcaaggaagttattgaggga
tttaaaaagaatgaggagaccctgaagcaatatgctaagaactgcatggacagactgcag
aaagaggaaaagcgttatcaagctcttaaagcccacgctgaggagaaactagaacaagca
aataaagccatagccgaggtccgcactaaacaaggtgcagaggtggcggcgctacaggta
cagctcaagagagagcagctgaaggttcagtccctagagaaggatctggaacaaaaggct
aaagaagtcaaagatgtcacagaactgtgtgatgagctgctgcttaaagtgcaaaagcat
ggtttttaa

DBGET integrated database retrieval system