KEGG   Danio rerio (zebrafish): 321383Help
Entry
321383            CDS       T01004                                 

Gene name
pfn2l, hm:zeh0341, wu:fb02e10, wu:fi35b08, zgc:86790
Definition
profilin 2 like
Orthology
K05759  
profilin
Organism
dre  Danio rerio (zebrafish)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    321383 (pfn2l)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    321383 (pfn2l)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   321383 (pfn2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 139 aa AA seqDB search
MSWQSYVDNLMADGSCQDAAIVGYTDAKYVWASSEGGTFSGITPDEIDVIGGKDREGFFT
SGLTLGKKKCSVIRDSLQVEGDWTMDIRTKSHNGEPTYNVSIGRAGKVLVLVMGKEGVHG
GGLNKKAYSMAKYLRDSGF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaaagctacgtggataacctgatggctgatggcagctgccaggatgccgcc
attgttggatacactgacgccaaatatgtctgggcatcgtcagagggtggtacgtttagc
ggtataacgcctgatgaaattgatgtcattggtggtaaagacagagagggctttttcacc
agtggactgactctaggcaagaagaagtgctctgtgatcagagacagccttcaggtggag
ggagactggacaatggacatcaggacaaagagccataatggagagccgacatacaatgtt
tccataggcagagctggcaaagtcttggttcttgtaatgggcaaagaaggggtccatgga
ggcggactgaataagaaggcatactcaatggcaaaatacttgagggattcggggttctaa

DBGET integrated database retrieval system