KEGG   Danio rerio (zebrafish): 321383Help
Entry
321383            CDS       T01004                                 

Gene name
pfn2l
Definition
(RefSeq) profilin-2
  KO
K05759  profilin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04810  Regulation of actin cytoskeleton
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    321383 (pfn2l)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    321383 (pfn2l)
Membrane trafficking [BR:dre04131]
 Others
  Actin-binding proteins
   Others
    321383 (pfn2l)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     321383 (pfn2l)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   321383 (pfn2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 321383
NCBI-ProteinID: NP_958874
ZFIN: ZDB-GENE-030131-34
Ensembl: ENSDARG00000012682
Vega: OTTDARG00000023938
UniProt: Q6AZA1
Position
2
AA seq 139 aa AA seqDB search
MSWQSYVDNLMADGSCQDAAIVGYTDAKYVWASSEGGTFSGITPDEIDVIGGKDREGFFT
SGLTLGKKKCSVIRDSLQVEGDWTMDIRTKSHNGEPTYNVSIGRAGKVLVLVMGKEGVHG
GGLNKKAYSMAKYLRDSGF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaaagctacgtggataacctgatggctgatggcagctgccaggatgccgcc
attgttggatacactgacgccaaatatgtctgggcatcgtcagagggtggtacgtttagc
ggtataacgcctgatgaaattgatgtcattggtggtaaagacagagagggctttttcacc
agtggactgactctaggcaagaagaagtgctctgtgatcagagacagccttcaggtggag
ggagactggacaatggacatcaggacaaagagccataatggagagccgacatacaatgtt
tccataggcagagctggcaaagtcttggttcttgtaatgggcaaagaaggggtccatgga
ggcggactgaataagaaggcatactcaatggcaaaatacttgagggattcggggttctaa

DBGET integrated database retrieval system