KEGG   Danio rerio (zebrafish): 321857Help
Entry
321857            CDS       T01004                                 

Gene name
clk4a, clk4, wu:fa26d04, wu:fb37c01
Definition
CDC-like kinase 4a
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     321857 (clk4a)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   321857 (clk4a)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    321857 (clk4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
14
AA seq 496 aa AA seqDB search
MRQTQRERSPWLRELSLEDRIMETRKRHRRDSHSSERENKYRKHHHHYKNSDGHCLEKRS
SNERLDTSEKHAVFRDHEHNGYAACKDKERNRDRSRSRERHRERERDRDWHHYSKSSGNS
MRSSRHRHRHRHRRSHPHSDSRSHRRKRSRSVEDDEEGHLVYHSGDMLRARYEIVCTLGE
GAFGKVVECIDHEKVGARIALKIIKNIERYRDAALSEVEVLEQINSLDCDRRYACVRMYD
WFDHHGHICIAFELLGLSTYDFLKENNFQPFYINHIRHMAYQIIRAVRFLHKNKLTHTDL
KPENILFVNSEYNIRYNSKMKRDERTVKNPDVKVVDFGNATYEHEHHTSVVSTRHYRAPE
VILDLGWSHSCDVWSVGCILIEYYLGSTLFQTHDSKEHLAMMERVLGPIPTHMLQKTRKS
RFVRNDKLDWDIHSSSGRYVRKQCKPLRQYLVSSSSDHEQLFDLIERMLEYDVTKRITLD
EAIKHPFFNSIRKSKK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagacagacgcagagagagcgctctccctggctgagggagttgagtctagaagacaga
ataatggagaccagaaagagacaccgacgagactcgcacagcagcgagagagagaacaaa
tacagaaaacatcaccatcattacaagaacagcgacgggcattgccttgagaaaagaagc
tcaaacgaaagactggacactagtgaaaaacacgcagtgttcagagaccatgaacacaac
ggctacgctgcctgtaaagacaaggagagaaaccgggaccgatccagatcccgtgagaga
caccgggaacgagagcgagatcgagactggcaccattacagtaaatcctctgggaacagc
atgcggagcagccggcacagacaccggcacaggcaccgccgttcacaccctcactctgac
tcgaggagccatcgcaggaaaagatccaggagtgttgaggatgatgaggaggggcacctg
gtctatcacagtggagacatgctgagagcaagatatgagattgtgtgtacacttggagaa
ggagcctttggcaaagtggtggagtgcattgatcatgaaaaagttggagctcgcattgcg
ctgaagatcattaaaaatattgagcgctatcgtgatgcggctctatctgaggttgaggtg
ctggagcagattaactcgctagactgtgacaggcgatatgcttgtgtgcggatgtacgac
tggtttgatcaccacgggcacatctgcattgcctttgagctgctgggcttgagcacgtat
gattttctgaaggaaaataactttcagcccttctatatcaaccacatcaggcacatggcc
taccagatcatcagagcagtcagatttcttcacaagaacaagctgacacacactgacctg
aagccagagaacatcctctttgttaattcggagtataacattaggtacaactcaaaaatg
aagagggatgagagaactgtgaagaatcctgatgtaaaagtggtggattttgggaatgca
acatacgagcatgagcatcatacatccgtagtgtccacacggcattatagagctccagag
gttattctggatttgggctggagtcattcctgtgacgtgtggagcgtggggtgtattctc
attgagtactatctaggatccactctatttcagacccatgacagtaaagagcatttggcc
atgatggagcgagtgctgggccccataccaacacacatgttgcagaaaacaaggaagtcg
aggtttgttcgcaatgataaactggactgggacattcacagctcttcaggacgttacgtc
aggaagcagtgcaaaccccttagacaatacttggtctcttctagctcagaccatgagcag
ctgttcgatctaatagagaggatgcttgagtatgacgttacaaagaggatcaccttggac
gaagccatcaaacacccatttttcaactctatcaggaagagcaagaaataa

DBGET integrated database retrieval system