KEGG   Danio rerio (zebrafish): 322007Help
Entry
322007            CDS       T01004                                 

Gene name
usp1, wu:fb43a02, zgc:55962
Definition
ubiquitin specific protease 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:dre03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 772 aa AA seqDB search
MPGLHSESGVVAAAGSPVKKSKLSLKFFQKKETKRALDFSEAPPEDNSNVTTEPQETICH
DQVVPLPCPSSPLTCEKRESLVPFVGLNNLGNTCYLNSILQVLYYCPGFKEAIKSLCHVA
KLKDKPQEEGVNNEGDSGENTLPVPMELLGSFHSLISSVEQLQSSFLLNPEKYNDGELAT
PPRKLLNALRQLNPMYEGYLQHDAQEVLQCILVNIQEACDTIKKEQTDNQDTTMINGTES
VQDGEGSSDSQLSGKRKSDTEAGNAKKKPKSQSKSKKNEENVPMTRSKRKSSSEISTENS
ATEQRNGTEEQEKDSTTEEEKNDSPPKDTGKRTRRGKLGWLRPSGKQPSIFSKFRSMGRI
TSHVGAKGETKEKSDCSSQEKQDKDNSENENKTHEVKQDLGKNEEQSGLDVLKWMFQGQL
VLRTRCLECECFTERREDFQDISVPVQEDETLSSDSSSEISPDPKTELKTLKWAISQFAS
VERIVGQDKYFCETCHHYTEAERSLLFDKTPEVITIHLKCFAANGSEMDPYAGLSKVNTP
LQTPLKLSLHEWCTQPDSPDYELFAVVMHSGVTISSGHYTTYIRMMDLHHTNIKPQTQDE
EHDRDQEEDMKQKKEETSQTDYDDGEVSFSLSGRGRNVARTSGTNNMSSKTAGKRCSEGV
GLLGGQRSITSYELSNSKQNNPDKPSSLSSRALLQNAVKKEPEEDCADAVADGTQVSFDL
ALRNLLDFEGKWMLFDDSEVRLYEEEDFLRACSPETCSTSTPYLLFYKRVSQ
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggctgcacagtgaaagtggagtggtggctgcagctggcagtcctgtgaagaaa
agcaaactctcattgaagttctttcagaagaaggaaaccaaacgcgctctggacttctca
gaggccccgccagaagacaacagtaacgttaccactgagccgcaagagactatttgtcat
gaccaggttgtgccattgccctgcccttcgtctcctcttacctgcgagaagcgcgagagc
ctggtccccttcgttgggcttaataatttggggaacacctgctacttgaatagcatcctt
caggttctatattactgtcctggttttaaagaagccatcaagtccttgtgtcatgtggct
aaactgaaagacaaaccgcaagaagagggtgtcaacaatgagggggactctggtgagaac
accctacctgttcccatggagctgttgggcagtttccacagcctcatttcctctgtggag
cagctgcagtccagcttcctgcttaacccagaaaaatacaatgatggagagctagccaca
ccacctcgtaaactgcttaatgcgctcaggcagctcaacccaatgtatgagggttacttg
cagcatgacgcacaagaggtcctgcagtgcattcttgtgaacattcaggaggcctgtgac
actatcaaaaaagagcaaacggacaaccaggacaccacaatgatcaatggaaccgagtct
gtccaggatggtgaagggagctctgacagccagctgagtggaaagagaaagagtgacaca
gaagcaggcaatgctaagaagaaaccaaaatctcaaagcaagtctaagaaaaatgaagaa
aacgtgcctatgacccgctcgaaacgcaagtcctccagtgaaataagcacagagaattca
gctactgagcagaggaatggcacagaagagcaagagaaggatagcaccacagaagaagag
aagaatgacagtccacctaaagatacaggcaagaggactaggagagggaagctgggctgg
ttgaggccatcagggaagcagcctagcatcttctccaagtttcgcagcatgggacgaatt
acttcacatgtaggagcaaaaggagagaccaaggagaagtcagattgtagttctcaggag
aaacaggacaaggacaactctgagaatgaaaacaaaactcatgaagttaaacaggatctg
ggaaagaatgaagagcaatcaggcctggatgtgctgaagtggatgtttcagggtcagctg
gtgttgcggacacgttgtctggaatgtgagtgtttcacagagagaagagaggattttcaa
gacatcagtgtgcctgtgcaagaagacgaaaccctctcttctgactctagttctgagatt
tctccagatcccaagactgagctgaaaactctaaagtgggccatatctcagtttgcatct
gttgagcgtattgtgggccaagataaatatttctgtgagacctgtcatcactacacagaa
gctgagagaagtctcctgtttgacaaaacgccagaagtcatcacaatccatctaaagtgc
tttgctgccaatggctcagagatggacccttatgctggcctttctaaggtgaacactcct
ctgcagactcctctgaaactttccctgcatgagtggtgcactcagcctgactctccagac
tatgagctcttcgccgtggtcatgcatagtggagtgaccatcagcagcggtcactacacc
acctacatccgcatgatggatctccatcacaccaacatcaagcctcagactcaggatgaa
gagcatgaccgagaccaagaagaagacatgaaacagaagaaagaggaaacttctcaaacc
gactatgatgatggcgaggtgtccttcagcttgtctggcagagggcgaaatgtggccaga
accagcggaactaataacatgtccagcaaaacggcaggcaagaggtgctctgaaggtgtt
ggccttttaggaggacaaaggagcatcaccagctatgaactcagcaacagcaagcaaaac
aatccagacaagccatccagcttgtccagtcgtgctctccttcagaacgctgtaaagaaa
gagccagaggaagactgcgctgatgctgtggcagacgggacacaggtcagttttgacctc
gctctcagaaatcttctggactttgaaggaaagtggatgctgtttgatgactctgaagtt
agactctatgaagaagaggacttcctccgtgcttgttctccagagacgtgctccacctct
acaccatacctgctcttctacaagagagtctctcagtaa

DBGET integrated database retrieval system