KEGG   Danio rerio (zebrafish): 322160Help
Entry
322160            CDS       T01004                                 

Gene name
pdia6
Definition
(RefSeq) protein disulfide-isomerase A6 precursor
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    322160 (pdia6)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     322160 (pdia6)
Chaperones and folding catalysts [BR:dre03110]
 Protein folding catalysts
  Protein disulfide isomerase
   322160 (pdia6)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    322160 (pdia6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 440 aa AA seqDB search
MRALLGVLACSLTVLSAYGLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKS
LAPEWKKAATALKGIVKVGAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTN
QAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDV
WLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTI
KVFRKGEEPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNEGILKKTCEDYQLCIIA
VLPHILDTGASGRNSYLEVMKTMAEKHKKKMWGWLWTEAGAQMELEASLGIGGFGYPAMA
AINSRKMKFALLKGSFSETGIHEFLRELSVGRGSTATVGGGALPKINTVQAWDGKDGELP
MEDDIDLSDVDLDDLEKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgctcctgggtgtgttggcgtgttctctgactgtactgtctgcttacggtctc
tacacctctagtgatgatgtggttgaactcaacccatccaactttaacagagaagtcatt
cagagtgacagtctctggctggtcgagttttatgctccctggtgtggtcactgcaagagt
ttggctcccgaatggaagaaagcagccacagctttaaagggcattgtgaaggtgggcgct
gtggatgccgatcaacacaactctctgggaggccagtatggagtccgaggctttccgact
atcaagatctttggaggcaacaagcacaagccagaggattaccaaggtggccgtacaaat
caagccattgtagatgcagctctgaatgctcttcgttctctggttaaagacagacttggt
ggaaagacaggaggctcagactacagcagacagagtggaggtggtgcgggcaataagaag
gatgtggtggagctgacggatgataactttgaccgaaccgtgctggagagcgatgatgtc
tggctggtggagttcttcgccccctggtgtggacactgcaaaaatcttgagccggaatgg
acagcagccgccacagaagtcaaagagcagacaaaggggaaagtgagactggctgctgag
gacgccactgttcaccagggcttggcaagccgctttgggattcgaggattcccgactatc
aaggtctttcgtaaaggagaggagcctgaggactatcagggtggacgaacccgatctgac
attgttgctcgtgcattggagctgtactctgataacatcccggctcctgagctgcaagag
gttttgaatgaaggcattttaaagaagacttgtgaggattatcagctgtgtatcatagct
gtgctgccacacattctagatacaggcgcatctggaagaaactcttacctggaggtgatg
aagacgatggcagagaaacataagaagaagatgtggggttggttgtggactgaagcaggg
gcgcagatggagctggaagcctctctggggattggtggatttggctatcctgccatggca
gccattaactctcgtaaaatgaagttcgctctgctcaaaggctcattcagtgaaacgggc
atccatgaattcctcagggaactttctgttggccgtggctccactgctacggttggaggc
ggagccttgccaaagatcaacaccgtccaggcttgggatggaaaagatggagagttgccg
atggaggatgacattgacctgagtgatgtggatctggatgatctggagaaggatgagtta
tga

DBGET integrated database retrieval system