KEGG   Danio rerio (zebrafish): 322160Help
Entry
322160            CDS       T01004                                 

Gene name
pdip5, pdi-p5, wu:fb51h08, wu:fc09e09
Definition
protein disulfide isomerase-related protein (provisional) (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dre04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 440 aa AA seqDB search
MRALLGVLACSLTVLSAYGLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKS
LAPEWKKAATALKGIVKVGAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTN
QAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDV
WLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTI
KVFRKGEEPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNEGILKKTCEDYQLCIIA
VLPHILDTGASGRNSYLEVMKTMAEKHKKKMWGWLWTEAGAQMELEASLGIGGFGYPAMA
AINSRKMKFALLKGSFSETGIHEFLRELSVGRGSTATVGGGALPKINTVQAWDGKDGELP
MEDDIDLSDVDLDDLEKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgctcctgggtgtgttggcgtgttctctgactgtactgtctgcttacggtctc
tacacctctagtgatgatgtggttgaactcaacccatccaactttaacagagaagtcatt
cagagtgacagtctctggctggtcgagttttatgctccctggtgtggtcactgcaagagt
ttggctcccgaatggaagaaagcagccacagctttaaagggcattgtgaaggtgggcgct
gtggatgccgatcaacacaactctctgggaggccagtatggagtccgaggctttccgact
atcaagatctttggaggcaacaagcacaagccagaggattaccaaggtggccgtacaaat
caagccattgtagatgcagctctgaatgctcttcgttctctggttaaagacagacttggt
ggaaagacaggaggctcagactacagcagacagagtggaggtggtgcgggcaataagaag
gatgtggtggagctgacggatgataactttgaccgaaccgtgctggagagcgatgatgtc
tggctggtggagttcttcgccccctggtgtggacactgcaaaaatcttgagccggaatgg
acagcagccgccacagaagtcaaagagcagacaaaggggaaagtgagactggctgctgag
gacgccactgttcaccagggcttggcaagccgctttgggattcgaggattcccgactatc
aaggtctttcgtaaaggagaggagcctgaggactatcagggtggacgaacccgatctgac
attgttgctcgtgcattggagctgtactctgataacatcccggctcctgagctgcaagag
gttttgaatgaaggcattttaaagaagacttgtgaggattatcagctgtgtatcatagct
gtgctgccacacattctagatacaggcgcatctggaagaaactcttacctggaggtgatg
aagacgatggcagagaaacataagaagaagatgtggggttggttgtggactgaagcaggg
gcgcagatggagctggaagcctctctggggattggtggatttggctatcctgccatggca
gccattaactctcgtaaaatgaagttcgctctgctcaaaggctcattcagtgaaacgggc
atccatgaattcctcagggaactttctgttggccgtggctccactgctacggttggaggc
ggagccttgccaaagatcaacaccgtccaggcttgggatggaaaagatggagagttgccg
atggaggatgacattgacctgagtgatgtggatctggatgatctggagaaggatgagtta
tga

DBGET integrated database retrieval system