KEGG   Danio rerio (zebrafish): 322412Help
Entry
322412            CDS       T01004                                 

Gene name
cpb1, wu:fb60d07, wu:fb69b08
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 265 aa AA seqDB search
MHLLKIGKNTGSNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLDRMDF
FVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVGASSNPCSDTY
CGSSPESEIESKNLANFIRTNKSIIKAYLTVHSYSQLLLFPYSYKYDLAAHHSELMSVSQ
GAIAALRSLYGTKYTSGPGAATIYPAAGGSDDWAYDLGVKYSYTFELRDEGRYGFLLPES
QIKPTCEETMLAVKYIANHVLNNLY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttctgaagattggaaagaatacagggtctaataagccagcagtcttcatggac
tgtggttttcatgccagagaatggatcacccatgctttctgccagtggtttgttaatgag
gctgtgtccacatatggcagtgatcctgacatgaccaaccttctggacagaatggacttc
tttgttctgcctgtcttcaacattgatggctatgaatacacctggaacagagacagaatg
tggagaaagacacgatccaagaacagcggcagcagttgtatcggtactgaccccaacaga
aacttcaatgctggatggtgcaccgttggagcttccagcaacccttgcagtgacacctac
tgtggaagcagtccagaatctgagattgagtccaagaatttggccaacttcatccgcacc
aacaagtccatcatcaaggcctacctgacagtccactcgtattcccagctgctgcttttc
ccctattcctacaaatatgacctggctgctcaccactcagagctgatgagtgtttctcag
ggagctattgcagctctgcgcagcctgtatggaaccaaatacactagcggccctggtgct
gcgactatctaccctgctgctggtggctctgatgactgggcttatgatctgggtgtgaaa
tactcctacacctttgagctgcgtgatgaaggccgttacggtttcctgctgcccgagtcc
cagatcaagcctacttgtgaggagaccatgctggctgtcaaatacatcgccaaccacgtc
ctcaacaacctgtactga

DBGET integrated database retrieval system