KEGG   Danio rerio (zebrafish): 322614Help
Entry
322614            CDS       T01004                                 

Gene name
arg2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00220  Arginine biosynthesis
dre00330  Arginine and proline metabolism
dre01100  Metabolic pathways
dre01230  Biosynthesis of amino acids
Module
dre_M00029  Urea cycle
dre_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    322614 (arg2)
   00330 Arginine and proline metabolism
    322614 (arg2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     322614 (arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 322614
NCBI-ProteinID: NP_955905
ZFIN: ZDB-GENE-030131-1334
Ensembl: ENSDARG00000039269
Vega: OTTDARG00000020844
UniProt: Q6PH54
Position
13
AA seq 347 aa AA seqDB search
MAMRGPLSRLLKSTLTSCQQNRSHSVAILGAPFSKGQKRRGVEHGPKAIRDAGLVERLSN
LDYPVHDFGDLTFKHLEKDEHFMHVPFPRTVGRANQLLSGAVSGAVGAGHTCIMLGGDHS
LAIGSVEGHSQQCPDLCLIWVDAHADINTPLTSPSGNLHGQSVAFLLKDLQNKMPKVPGF
SWMKPFLSARDLVYIGLRDVDPGEHVFLKTLGIQYFSMRDIDRMGIQRVMEVTLDHLLAR
KQRPIHLSFDIDAFDPSLAPATGTPVNGGLTYREGIYITEEIHNTGLLSVMDVVEVNPTL
GAAPEAVEATTSLAVDIVASALGQTREGAHVSFPKITEPKEDTELRL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagaggaccactgtccagactactgaaatccaccttgacttcctgccagcag
aacagatcacattctgttgccattttgggagctccgttttccaaaggacagaaaaggaga
ggggtggagcatggacccaaagctattcgggatgcaggtctggtggaaagactttcaaat
cttgactaccctgttcatgatttcggagacctgaccttcaagcatctggaaaaagatgag
cacttcatgcacgtgccgttcccacgcacagttggacgtgccaatcagttgctctctgga
gctgtgagtggggcggtgggagcaggacacacttgcatcatgctggggggagatcacagc
ttagcgattggctcagtggaaggccattctcagcagtgtcctgacctgtgtctgatatgg
gtggacgcacatgcggatatcaacacgcctctgacttcaccttcgggaaacctccacggc
cagtctgtagctttcttactaaaggacctgcagaacaagatgcccaaagttcccggattt
tcctggatgaagccgttcctgtctgccagagatctggtgtacattggtcttagagatgtg
gatccaggcgagcatgtattcctaaagaccctgggaattcagtacttctccatgcgggac
attgacagaatgggcattcagagagtaatggaggtcactctggatcacctcttggcaagg
aagcaaaggccgatccacctgagctttgacattgatgcttttgacccatcgctggctcct
gccactggaactccagttaacggcggactgacctacagagagggcatctacataacagag
gagatccacaacacaggtttgctgtctgtgatggatgtggttgaagtgaaccccacactc
ggagcggcacctgaggctgtggaagccacgactagtctagccgttgacatagttgcatcc
gctctgggccagacgcgtgaaggcgcacacgtctccttcccgaagattacagaaccaaaa
gaagacactgagctgcggctgtag

DBGET integrated database retrieval system