KEGG   Danio rerio (zebrafish): 322732Help
Entry
322732            CDS       T01004                                 

Gene name
alox12, wu:fb72a11, zgc:64120
Definition
arachidonate 12-lipoxygenase (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dre00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 670 aa AA seqDB search
MEYKVTVATGTSEYSGTNNYVYVTLIGEKGKSERTLLDNPGLDFCRGAVDDYIVKSDTDL
GPLILVRLEKHKYFIEDNWFCRYVKVSVPGERCCYTFPCYRWLVGDGVFVELREGTAKKL
SEDSLPLEMAHRQSELQERQKTYRWVAWAPGIPKCIDAKSEADLPQDARFDNEKRSDFEG
SLHYALLELSLKKLAIRFGKSWSDLEDFRRIFWKLRSPIAEYTMEHWKEDWFFAYQFLNG
SNPRNITRLKKVPSNFLVTGDMVQSSLIPTTTLNEELKKGNIFLVDHAILDGIPANVIRN
SPQYIAAPLCLLYEHPEKGLIPIAIQLEQKPDKDTPVFLPSDPPLAWLLAKMWVRHAEFQ
VFQLLSHLLRTHLMVEVICVATLRQLPAVHPIYKLLTPHLRYTLEINCRGRTQLLSPEGI
FKRVVSTGGEGLLILAQREYKVLTYRSLQPKFDFLDRGVTKVKGYVYRDYSLMLWDVIQN
FVSGIVSLYYQCDSDVQEDSELQAWIHDVAVEGFVDVPEFGLASDMKTKEELITLLSVAI
FTSTAQHAATNNGQFDWCAWVPNTPCTMRHPPPRDKDAVTMEMIMDTLPDISQSCVQMAI
TWHLGRAQPDAIPMGQYVEQYFTEPAALKVIDKFRKELKELEDKIMAQNEGLELQYLYLC
PSRMENSITI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaaagtgacagtggccaccgggacttctgaatattcagggaccaataattat
gtgtacgtgactctgattggagagaaaggaaagagcgagaggacgctgctggacaatcct
ggcctggacttctgcagaggagctgtggatgattacatagttaaaagcgatactgatttg
ggccccctgattctggtgcgactggagaagcacaagtacttcatagaagacaactggttc
tgccgctacgtgaaagtcagtgtacctggagaaagatgttgttacacatttccttgttac
cgctggcttgtgggagatggagtgtttgtagagctcagagaaggcacagccaaaaagctg
agcgaagacagtctgccgctggaaatggctcacagacaatcagagcttcaggagaggcag
aaaacatacagatgggttgcatgggctcctggcattcccaaatgcattgatgcaaaaagt
gaagctgatctgccccaggacgctcgatttgacaacgagaaacgcagtgattttgaggga
tctcttcattatgctctgttggagctctcactgaaaaaattggcaatccggtttggaaag
tcctggagtgacctggaggatttcaggaggatcttctggaaactaagaagccccatagct
gaatacaccatggagcactggaaagaagactggttttttgcttaccagttcttgaacggc
tcaaacccacggaatatcaccagattgaaaaaggtgccttcaaacttccttgtcactgga
gatatggttcagtcatctctgatacccacaaccactctgaatgaggaactcaagaaagga
aacattttcctggttgatcatgcaatactggatgggattcctgccaatgtaatcagaaac
agcccccagtatattgctgccccactctgcttactgtatgaacaccctgagaaagggctc
attcccatcgccatacagcttgaacagaaacctgataaggacacacccgtatttctgccc
agtgatccacctctggcctggttgttggctaagatgtgggttcgtcatgctgaattccag
gtctttcagttgttgtctcatctgctgcgcacacatttgatggtagaagtgatctgtgtg
gccacactacggcagctgccagctgttcaccccatatataagctcttgactccacacttg
aggtacacgctggagattaactgtcgtggcagaacacagctcctctctccagagggcatc
ttcaaaagggtggtgtccacaggtggagaaggtctcttgatattggctcaaagggagtat
aaagttctgacctatcgctctcttcagcctaaatttgacttcttggacagaggggttact
aaagtgaaaggctatgtttacagagactactctctgatgctgtgggatgtgattcagaat
tttgtttcaggaattgtttccctgtactaccagtgtgacagtgacgtgcaagaggactct
gagcttcaggcctggattcatgatgtggctgtggaaggctttgtggatgttcctgaattt
ggcctggccagtgatatgaagacaaaagaggagctgatcactctgttaagtgtggcgatc
ttcaccagcacagcacaacatgctgccacaaacaacggacagtttgactggtgcgcttgg
gtacccaacaccccctgcaccatgagacaccccccaccaagagataaagatgcagtgacc
atggaaatgattatggacacgctgcctgacatcagccagtcctgtgtgcagatggccatc
acatggcatttgggccgggcacagcctgatgcgatcccaatgggccagtatgtggagcag
tacttcactgaacccgctgctttgaaggtgattgacaaattcaggaaagagctgaaagaa
ctggaggacaagataatggcccagaacgagggactcgaacttcagtacctttacctttgt
ccaagccgcatggaaaacagcatcactatttag

DBGET integrated database retrieval system