KEGG   Danio rerio (zebrafish): 322732Help
Entry
322732            CDS       T01004                                 

Gene name
alox12, wu:fb72a11, zgc:64120
Definition
arachidonate 12-lipoxygenase (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    322732 (alox12)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     322732 (alox12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 670 aa AA seqDB search
MEYKVTVATGTSEYSGTNNYVYVTLIGEKGKSERTLLDNPGLDFCRGAVDDYIVKSDTDL
GPLILVRLEKHKYFIEDNWFCRYVKVSVPGERCCYTFPCYRWLVGDGVFVELREGTAKKL
SEDSLPLEMAHRQSELQERQKTYRWVAWAPGIPKCIDAKSEADLPQDARFDNEKRSDFEG
SLHYALLELSLKKLAIRFGKSWSDLEDFRRIFWKLRSPIAEYTMEHWKEDWFFAYQFLNG
SNPRNITRLKKVPSNFLVTGDMVQSSLIPTTTLNEELKKGNIFLVDHAILDGIPANVIRN
SPQYIAAPLCLLYEHPEKGLIPIAIQLEQKPDKDTPVFLPSDPPLAWLLAKMWVRHAEFQ
VFQLLSHLLRTHLMVEVICVATLRQLPAVHPIYKLLTPHLRYTLEINCRGRTQLLSPEGI
FKRVVSTGGEGLLILAQREYKVLTYRSLQPKFDFLDRGVTKVKGYVYRDYSLMLWDVIQN
FVSGIVSLYYQCDSDVQEDSELQAWIHDVAVEGFVDVPEFGLASDMKTKEELITLLSVAI
FTSTAQHAATNNGQFDWCAWVPNTPCTMRHPPPRDKDAVTMEMIMDTLPDISQSCVQMAI
TWHLGRAQPDAIPMGQYVEQYFTEPAALKVIDKFRKELKELEDKIMAQNEGLELQYLYLC
PSRMENSITI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaaagtgacagtggccaccgggacttctgaatattcagggaccaataattat
gtgtacgtgactctgattggagagaaaggaaagagcgagaggacgctgctggacaatcct
ggcctggacttctgcagaggagctgtggatgattacatagttaaaagcgatactgatttg
ggccccctgattctggtgcgactggagaagcacaagtacttcatagaagacaactggttc
tgccgctacgtgaaagtcagtgtacctggagaaagatgttgttacacatttccttgttac
cgctggcttgtgggagatggagtgtttgtagagctcagagaaggcacagccaaaaagctg
agcgaagacagtctgccgctggaaatggctcacagacaatcagagcttcaggagaggcag
aaaacatacagatgggttgcatgggctcctggcattcccaaatgcattgatgcaaaaagt
gaagctgatctgccccaggacgctcgatttgacaacgagaaacgcagtgattttgaggga
tctcttcattatgctctgttggagctctcactgaaaaaattggcaatccggtttggaaag
tcctggagtgacctggaggatttcaggaggatcttctggaaactaagaagccccatagct
gaatacaccatggagcactggaaagaagactggttttttgcttaccagttcttgaacggc
tcaaacccacggaatatcaccagattgaaaaaggtgccttcaaacttccttgtcactgga
gatatggttcagtcatctctgatacccacaaccactctgaatgaggaactcaagaaagga
aacattttcctggttgatcatgcaatactggatgggattcctgccaatgtaatcagaaac
agcccccagtatattgctgccccactctgcttactgtatgaacaccctgagaaagggctc
attcccatcgccatacagcttgaacagaaacctgataaggacacacccgtatttctgccc
agtgatccacctctggcctggttgttggctaagatgtgggttcgtcatgctgaattccag
gtctttcagttgttgtctcatctgctgcgcacacatttgatggtagaagtgatctgtgtg
gccacactacggcagctgccagctgttcaccccatatataagctcttgactccacacttg
aggtacacgctggagattaactgtcgtggcagaacacagctcctctctccagagggcatc
ttcaaaagggtggtgtccacaggtggagaaggtctcttgatattggctcaaagggagtat
aaagttctgacctatcgctctcttcagcctaaatttgacttcttggacagaggggttact
aaagtgaaaggctatgtttacagagactactctctgatgctgtgggatgtgattcagaat
tttgtttcaggaattgtttccctgtactaccagtgtgacagtgacgtgcaagaggactct
gagcttcaggcctggattcatgatgtggctgtggaaggctttgtggatgttcctgaattt
ggcctggccagtgatatgaagacaaaagaggagctgatcactctgttaagtgtggcgatc
ttcaccagcacagcacaacatgctgccacaaacaacggacagtttgactggtgcgcttgg
gtacccaacaccccctgcaccatgagacaccccccaccaagagataaagatgcagtgacc
atggaaatgattatggacacgctgcctgacatcagccagtcctgtgtgcagatggccatc
acatggcatttgggccgggcacagcctgatgcgatcccaatgggccagtatgtggagcag
tacttcactgaacccgctgctttgaaggtgattgacaaattcaggaaagagctgaaagaa
ctggaggacaagataatggcccagaacgagggactcgaacttcagtacctttacctttgt
ccaagccgcatggaaaacagcatcactatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system