KEGG   Danio rerio (zebrafish): 323107Help
Entry
323107            CDS       T01004                                 

Gene name
pgam1a, pgam1, wu:fb81h05
Definition
phosphoglycerate mutase 1a
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    323107 (pgam1a)
   01230 Biosynthesis of amino acids
    323107 (pgam1a)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    323107 (pgam1a)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    323107 (pgam1a)
Enzymes [BR:dre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     323107 (pgam1a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   323107 (pgam1a)
  Exosomal proteins of melanoma cells
   323107 (pgam1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
13
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESCWNQENRFCGWFDADLSETGAQEAKRGGQALKDAGFEFDICYTSVL
KRAIRTLWIVLDSIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
IPPPSMDEDHDFYSIISKDRRYGDLTEDQLPSCESLKDTIARALPFWNDEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacaagctggttcttattcgccatggcgagagctgctggaaccaagagaat
cgattctgtggctggtttgacgcggacctgagcgagacaggggctcaggaggcgaagaga
ggaggtcaagctttaaaggatgcagggtttgagtttgacatttgttacacctctgtgctg
aagagggctatccggacactgtggattgttctggacagtattgatcagatgtggctgcct
gtgcacaggacctggcggctgaatgaacgccattacggtggtctcactgggttaaacaag
gccgaaactgcagccaagcatggtgaagcccaggttaaaatttggaggcgctcctatgac
attccaccacccagtatggatgaagatcatgacttttacagcatcatcagcaaggaccga
cgttatggtgatctgactgaggaccagctgccttcttgtgagagtctgaaggacactatt
gcacgtgctctgcctttctggaatgatgaaattgtgcctcaaatcaaggagggaaagcgg
gtgttgattgccgctcatgggaacagtttgagaggcattgtgaagcacttagaaggaatg
tctgaggaggccatcatggagctgaatctgcccacagggatccctattctttacgagctg
gacaagaacctgaagcccatcaagcccatgcagttcctcggggatgaggaaaccgttcgc
aaagccatggaggctgtggcagctcagggcaaagccaagaaatag

DBGET integrated database retrieval system