KEGG   Danio rerio (zebrafish): 323181Help
Entry
323181            CDS       T01004                                 

Gene name
kat7b, kat7, myst2, wu:fb92a01, wu:fi16d05
Definition
K(lysine) acetyltransferase 7b (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     323181 (kat7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 568 aa AA seqDB search
MPRRKGHKSPFQLILNKPINTERTAGSSSDGTADSDDSGDHEKTDSSHGEANQRNNTRMT
RASLRLSQSSQDAPPDIKQAVERDESPPRTPTGNAPSSESDIDISSPNASHDESVTKDQK
DSGSDPSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFAISGCPLYHNLSADEC
KVKAIEREKQDEERSQGQNEENRHATRHQAPTPRQVRYKEKVIEMRKRRDSGLSKDQKEK
YMEHRQTHGTTREPLLENITSDYDLELFRKAQARASEDLEKLRLQGQITEGSNMIKTIFF
GRYELETWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHMAKCVWKHPPGDEVYRKG
ATSVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSK
EKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSY
WKEVLLRYMYNFKGKEISIKEISQETAVNPVDIVSTLQSLQMLKYWKGKHLVLKRQDLID
DWKAKETKRGNSKTIDPGSLKWTPPKGT
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggcggaagggccataaatctccatttcagctgatcttaaataaacccataaat
actgagagaactgcgggcagtagttcagacgggactgcagattcggatgactctggagat
catgagaagaccgacagctctcacggtgaagccaaccagcgcaataacacccgcatgacc
cgagcatcactgcgccttagccagagctctcaagatgctccacccgatataaagcaagca
gtggagcgagatgagtctcctcccaggacgccaacaggaaacgccccgtcgtctgaatca
gacatcgacatatccagccccaacgcatcccacgatgagagcgtgactaaagaccagaaa
gactctggcagcgatccctctcatcggccaaaacgccgccgctttcatgagagctacaac
ttcaatatgaagtgccccacacctgggtgcaattctctgggacatttaacaggtaaacat
gagcgccatttcgccatttcaggatgccctctctatcataacctctctgcagatgaatgc
aaggtgaaggctatcgagcgtgagaaacaagatgaagagcgcagtcaggggcagaacgag
gagaacaggcacgctactcgacatcaggcaccaactccaagacaggtccgatataaagag
aaagtcattgagatgaggaagaggagagattctgggctgagtaaagaccaaaaggaaaag
tacatggagcacagacaaacgcatggaaccactcgcgaaccattgctggagaacatcacc
agtgattatgatctggagctcttcagaaaagctcaggctcgtgcgtcagaggatctggag
aaactgcgtcttcaaggtcagatcacagagggcagtaacatgatcaaaaccatttttttt
ggccgctatgagctggagacgtggtaccactctccatacccagaggaatatgcccgtctg
gggcgactgtatgtctgtgagttctgcctcaagtacatgaagagccagaccatcctgcgc
agacatatggccaaatgtgtgtggaaacatcctccaggggatgaagtctatagaaaaggt
gccacctctgtgtttgaggttgatggaaaaaagaacaagatctactgccagaacctctgc
ttgctggccaagctgtttttggaccataaaacactgtattatgatgtggagcctttcctg
ttttatgtcatgacagaagctgataacacaggctgtcaccttgtgggatatttctcaaag
gagaagaactcgttcctgaattacaatgtgtcttgtatcctgaccatgccacagtacatg
agacagggctatggcaagatgctgattgactttagttacctgctgtcgaaggttgaagag
aaggtgggctctcctgaacgcccgctctctgatctgggcctcatcagttatcgcagctat
tggaaggaagtcctgctacgctacatgtacaattttaagggcaaagagatctccattaaa
gagatcagtcaagagactgcagtgaacccagtggatatcgtcagtacactgcagtccctt
cagatgctcaagtactggaaaggaaaacatctagttttgaaaagacaggacctgattgac
gattggaaggccaaagagactaaaaggggaaacagcaagaccatcgaccccggctctctc
aaatggacccctcctaaaggaacctaa

DBGET integrated database retrieval system