KEGG   Danio rerio (zebrafish): 323579Help
Entry
323579            CDS       T01004                                 

Gene name
cltca, cb1033, cltc, wu:fc03e11, wu:fc49a11, wu:fd07f02
Definition
clathrin, heavy polypeptide a (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 1680 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMADPNT
PIRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGDSQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAGFGQFKMEGNTEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QQFPKKAVDVFFPPEAQNDFPVAMQISSKHDVVYLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHDATAGIIGVNRKGQVLSVCVEEENIIQYITNVLQNPDLALRMAVRNNLAGA
EELFGRKFNNLFAGGNFAEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQFPKIVLYAKKVGYTPDWIFLLRNVMRISPDQGLQFAQMLVQDE
EPLADITQIVDVFMEYNLVQQCTSFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTNYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLTELFESFKSFEGLFYFLGSIVN
FSQDPEVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGTCDQELINVCNENSLFKSLSRYLVRRRDPELWASVL
LETNPFRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISSELFEEAFAIFKKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGLVKESIDSYIKADDPSAYMEV
VQAADQSGNWEDLVKFLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEFDNAIITMMS
HPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFRPLLLNDLLIVLSPRLDHSRAVNFFS
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFISEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDTELAEELLQWFLDE
NKKECFAACLFTCYDLLRPDVVLETSWRNNIMDFAMPYFIQVMREYLSKVDKLETSESLR
KEEEQATETQPIVYGTPQLMLTAGPSVPVPPQQGYGYGYTAAPGYPPQAPQAQPGFGYGM
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcctgcccatcagattccaggagcacctgcagctccaaaatttggggatc
aacccagccaacattgggttcagcaccctgacaatggaatcggataagttcatctgtgtc
cgggagaaggttggagaacaggcgcaggtggtgatcattgatatggcggacccaaacacc
cccatccgcaggcccatctctgcagatagtgccatcatgaaccctgcgagcaaagtcatt
gccctcaaagctgccaaaacccttcagatctttaatatcgagatgaagagtaagatgaaa
gcccacaccatgaccgatgacgttactttctggaagtggatctccctcaacactgttgcc
ctcgtgaccgataacgccgtctatcattggagcatggagggagactctcagccggtcaaa
gtgtttgacagacattccagtctggcaggctgtcaaatcatcaactaccgcactgatgcc
aagcagaagtggctgctgctcattggcatttctgctcagcaaaacagagttgttggagcc
atgcagctctactctgttgataggaaggtgtcacagcctattgaggggcacgccgctggc
tttggtcaattcaaaatggagggaaacactgaagaatccactctcttctgtttcgctgtg
cgaggtcaggcaggcggaaagcttcacattattgaagtgggcacaccaccaacaggcaac
cagcaattcccaaagaaagccgtggatgtgttcttcccaccagaagcacagaatgacttc
cctgtagccatgcagatcagctccaaacatgatgttgtgtatctcatcactaaatatggc
tacattcatctgtatgacctggagacgggcacctgcatctacatgaaccgaatcagcggg
gagaccatttttgtgactgcgccccatgatgccacagctgggattatcggcgtcaacagg
aaaggacaggtgttgtcagtgtgtgttgaggaggaaaacatcatccagtacattaccaat
gtgctgcagaatccagacctggctttacggatggcagtccgcaataatctggctggagct
gaggagctgttcggacgcaagtttaacaacctctttgccggtggaaattttgcagaggca
gctaaagtagctgctaatgctccaaagggtatcctgcgcacccctgacaccatacgccgg
ttccagagtgtcccggctcaaccaggccagacgtccccactgctgcagtattttgggatc
ctcctggaccagggccagctcaacaagtttgagtctttggagctctgcagacccgtcctt
cagcagggccgcaaacaactgctggagaaatggctgaaggaggacaagcttgaatgctca
gaggagctgggtgacctggtgaagtctgtggacccgactcttgctctcagcgtctatctg
agggccaacgtacccaacaaagtcattcagtgttttgcagaaactggccagttccctaag
attgtcctgtacgccaaaaaggtgggctacactccagactggatcttcctgctgaggaac
gtgatgcggatcagtccagatcagggtctgcagtttgctcagatgcttgttcaggacgag
gaaccgctggctgacatcacacagatcgttgatgtgtttatggagtataacctggtccag
cagtgcacttccttccttttagatgctttgaagaacaaccggccatcagaaggaccactg
cagacccgtctgctggagatgaacctgatgcacgcaccacaggttgcagatgccatccta
ggaaaccagatgttcaccaactacgatcgtgcccacatcgcccaactgtgtgagaaagca
ggacttcttcagagagctttagagcattacaccgacttgtatgacatcaaacgagctgtc
gtgcacacacacctgctcaacccggagtggctggtcaactactttggctctctgtcagtg
gaggactctctggagtgtctgagggccatgctgtctgctaacatcagacagaatctccag
atctgcgtccaggtggcgtccaagtatcacgagcagctgagcacacagtccctcaccgag
ctctttgagtcgttcaagagttttgagggccttttctactttcttggctcaatcgtaaac
ttcagccaggacccagaggtgcatttcaaatacatccaggccgcatgcaagacgggccaa
atcaaagaggtggagcgcatctgtcgggaaagcaactgctacaaccctgaacgtgtcaag
aactttctcaaggaagctaaactcactgaccagctgcctctcattattgtgtgcgatcgc
ttcgacttcgtccacgaccttgttctttacctgtacagaaacaacctgcagaagtacatc
gaaatctacgtccagaaggtaaacccaagccgtctgcctgtggtgattggaggtctgctg
gatgtggactgctctgaggatgtcatcaaaaacctgatcctggttgtacggggacagttt
tccaccgatgagctggtggcagaagtggagaagagaaacagactgaagctgttgttgccc
tggctggagtctcgtatccacgagggctgtgaggagccagctacccacaatgccctggcc
aagatctacatcgacagcaacaacaaccctgaacgcttcctgcgggagaacccatactac
gatagccgcgtggtggggaaatactgcgaaaaacgagaccctcatctggcctgtgtggcc
tatgagagaggaacgtgtgaccaggagctgatcaacgtttgcaatgagaactcgctgttc
aagagtttgtcccgctatctggtgcgccgcagggaccctgagctatgggccagtgtgctt
ctggagaccaaccccttcaggaggccccttattgaccaggtggtgcagacagccctgtca
gagactcaggacccagaggaggtgtcagtcacagtgaaggccttcatgactgctgacctg
cccaatgaactcattgagctgctggaaaagattgtcctggacaactccgtcttcagtgaa
cacagaaacctgcagaacctgctcatcctaacagccatcaaagctgaccgtactcgggtc
atggagtacatcaaccgcctggacaactacgatgccccagacatcgccaacatcgccatc
agcagcgagctgtttgaggaggccttcgccatcttcaagaaattcgatgtcaacacctct
gcagtgcaggttctgatcgagcacattggtaatctggaccgggcctatgagtttgcggag
cgctgcaatgaacctgcggtgtggagtcaactggccaaggctcagcttcagaagggtctc
gtcaaagagtccatcgactcctacatcaaagctgatgatccttcagcttacatggaagtg
gtccaagctgctgaccaaagtggaaactgggaggacctggtgaagtttttgcagatggcc
agaaagaaggccagagagtcttacgtggagactgagctgatcttcgctctggccaaaacc
aaccgtctcgctgaactggaggagtttatcaatggaccaaataatgcacacatccagcag
gttggagatcgctgctatgatgagaagatgtacgaggcggccaaacttctctacaataac
gtctccaacttcggccgcttggcttccactctggtccacttgggcgagtatcaagccgct
gtcgatggtgcccgcaaggccaacagcactcgcacatggaaagaggtttgctttgcctgt
gtggatggaaaggagttcagattggctcaaatgtgcggccttcatatcgtggttcacgca
gatgaattggaagagctcatcaactactatcaggaccgtggctactttgaggagctgatc
accatgctggaagcggcgctggggttggagcgcgctcatatgggcatgttcacagagctc
gccatcctctactccaaattcaagccacagaagatgagggagcacctggagctcttctgg
tccagagtcaacatcccaaaggttttgagggctgcagagcaggctcacctgtgggcagaa
ctggttttcctgtacgacaagtatgaagagtttgataacgccatcatcaccatgatgagc
catcccacagacgcctggaaagagggacagttcaaggacatcatcaccaaggtggccaat
gtggaactgtactacaaagccatccagttttatctggaattcaggcccttgttactgaac
gacctgctcatagttctttctccaagactcgatcactcgcgagccgtcaacttcttcagc
aaggttaagcagcttcctctggtcaagccttacctgcggtcagtacaaaaccacaacaac
aagtcagtcaatgaagcacttaacaacctcttcatctcagaggaggactatcaggccctc
aggacgtccatagacgcgtacgataacttcgacaacatctctctggctcagcgtctggag
aaacacgagttaattgagttcaggagaatcgctgcttacctcttcaaggggaacaaccgc
tggaagcagagcgtggagctgtgcaagaaagacaagctctacaaggatgccatgcaatat
gcatcggagtcaaaggacacagagctggccgaggagctgctgcagtggttcctggatgag
aataagaaggagtgttttgccgcctgcctcttcacctgctacgatctgctccggcctgac
gtggtgctggagacatcctggaggaacaacatcatggacttcgccatgccgtacttcatc
caggtcatgagggaatacctcagcaaggtggacaagctagagacctctgagtccttgagg
aaagaggaggagcaagcgacagaaactcaaccaattgtttatggcacaccccagctcatg
ctgacagcaggccccagtgtgcccgtcccaccacagcaggggtatggctatggttacaca
gcagctcctggttatccccctcaggctcctcaggcccagccgggcttcggttatggcatg
taa

DBGET integrated database retrieval system