KEGG   Danio rerio (zebrafish): 323613Help
Entry
323613            CDS       T01004                                 

Gene name
hexa, fc04h11, si:dkey-35i22.2, wu:fc04h11, wu:fv09f06
Definition
hexosaminidase A (alpha polypeptide) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    323613 (hexa)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    323613 (hexa)
   00603 Glycosphingolipid biosynthesis - globo series
    323613 (hexa)
   00604 Glycosphingolipid biosynthesis - ganglio series
    323613 (hexa)
   00511 Other glycan degradation
    323613 (hexa)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    323613 (hexa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     323613 (hexa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 541 aa AA seqDB search
MLCLLKFTPLFLVVAVCHGWLFGDLFEKQKELDEISLWPLPQKYQSSAVAFKLSAASFQI
VHAKQSTAGPSCSLLENAFRRYFEYMFGELKRQEKSRKKAFDSDLSELQVWITSADPECD
GYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFP
RFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKG
AYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSPSG
SFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQGFG
TDYSKLESFYIQRLLDIVAATKKGYMVWQEVFDNGVKLKDDTVVEVWKGNDMKEELQNVT
GAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTGTDAQKKLVIGGEACLWGEYVDATN
LTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPAEPLFVGHCRHEYKG
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtctgctcaagtttacccctctgtttttggtggtagccgtatgtcacggctgg
ctttttggagatctttttgaaaaacagaaagagctggatgaaatctctctatggcctcta
ccgcagaaataccagtcgtccgcggtcgcttttaaactcagcgccgccagctttcaaatc
gtccacgccaaacagtccaccgccggaccgagctgcagtctactcgagaatgcatttcgc
agatattttgaatacatgtttggagagctgaaaaggcaggagaaaagccgaaagaaagcg
tttgattcagatctctcggagctgcaggtatggatcacatcagctgatccggagtgcgac
ggttacccgagtcttcgaaccgacgagtcatattcgctgtcggttgatgaaacctcagct
gtgctcaaagctgctaatgtatggggagctttgcgaggactggaaacattcagccagttg
gtctatgaggatgactatggagttagaaatattaataagaccgacatatcagattttcca
cggtttgcccaccgaggaatccttctggactcgtctcgccattttctgccactcaaagtc
attttggccaacttggaagctatggccatgaacaagtttaacgtcttccactggcacatt
gtggatgatccgtcgtttccttttatgagccgtactttcccagagttgagccaaaaggga
gcctatcacccatttacacatgtgtacactccatctgatgtgaagatggtcattgaattt
gctcgcatgagggggatcagggtcgttgcggagttcgacaccccagggcacacgcagtca
tggggcaatggcataaaggatctgctaacaccttgttacagtggctctagtccttcagga
tcatttgggcccgtgaaccccatcttaaactcctcttatgagttcatggcacagcttttc
aaagagatcagcaccgtctttcctgacgcttacattcacctagggggagatgaggtcgac
ttttcttgttggaagtccaatcctgatattcagaagtttatgaatcagcaaggctttggc
acagactacagcaaactggagtccttctacattcaaaggttacttgatattgtggctgct
accaaaaaaggttacatggtgtggcaggaggtgtttgataacggggtcaagctaaaggat
gacactgttgtggaggtgtggaaagggaacgatatgaaggaggagctccagaatgtgact
ggggcaggatttacaaccattctttctgccccttggtacctggactacattagctatgga
caggactggcaacgctactacaaagttgagccacttgatttcactggcacagatgcacag
aagaagctggtgattggtggagaggcttgtctttggggagagtatgtggacgccaccaac
ctcactcctcgactctggccaagagccagtgccgtcgctgagaggttatggagtgatgca
agcgtgaccgatgtcggaaatgcttatactcgcctggcccagcatcgctgccgcatggtc
aggagaggcatacctgcagaacctctatttgttggccactgccgtcatgagtacaagggt
ctgtga

DBGET integrated database retrieval system