KEGG   Danio rerio (zebrafish): 324201Help
Entry
324201            CDS       T01004                                 

Gene name
dlat, wu:fc14f10, wu:fc21f08, wu:fc86g11, wu:fj57d06
Definition
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    324201 (dlat)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    324201 (dlat)
   00020 Citrate cycle (TCA cycle)
    324201 (dlat)
   00620 Pyruvate metabolism
    324201 (dlat)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     324201 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 652 aa AA seqDB search
MLRLVQRVRPSARLTRPSVLSGPAAAPAASPRPGPVSCHHLKRYHSSGPARIRSSFHGRR
VCNSILSNRSWGLRSQTAAFSQSMRVYSLPPHQKVELPALSPTMQMGTIARWEKKEGDKI
NEGDLIAEVETDKATVGFEMLEECYLAKILVAEGTRDVPIGAVICITVDKPELISSFKDF
TLDKITSSAPAAAAPPPPATPTSAPAAPQVPGSSYPPHMKVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKIMISEGTRDVPLGTPLCIIVEKESDI
SAFADYVETGVAASPPPAPTLVATPPPAAAPAAPIPAPAAAPAAPAAARKGRVFASPLAK
KLAAEKGVDITQVTGTGPDGRVTKKDIDSFVPPKLTPAAAAAPSAPTPSPPAAPAYAAVP
TGTFTDVPISNIRKVIAQRLMQSKQTIPHYYLSIDVNMDQVLELRKELNAEVKAENIKLS
VNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPVGLITPIVFNAHIKGLA
NISKDVSALAAKARDGKLQPHEFQGGTFTISNLGMYGIKHFSAIINPPQACILAVGGSEK
RLLPADNEKGFDVANMMSVTLSCDHRVVDGAVGAQWLAEFRKFLEKPFTMLL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtttagtgcagcgagtgcgcccatctgccaggctcacccggcccagtgtcctc
tcgggccctgctgctgctcctgctgccagtcctcgacccggaccagtgtcctgccatcat
ctcaaacggtaccactccagcgggcctgcccggatccggagctcgtttcacggtcggcga
gtctgcaacagcatcctcagtaacagatcatgggggctgagaagtcaaacggccgctttc
agtcagagcatgagagtctacagcctgccgccgcatcagaaggtggaactacctgccttg
tcccccacaatgcagatgggcactattgcacgctgggagaagaaggaaggtgacaaaatc
aatgagggagatttgattgctgaggttgaaacagacaaggctacagttggatttgaaatg
ttggaagagtgctatctagccaagatcctggttgcagagggtacaagagatgtgcccatt
ggagcagtcatttgtattactgttgacaaacctgagctcatctcttcattcaaggacttt
acattggataaaatcaccagctctgcccctgctgctgcagctcctccccctccagccaca
cccacttctgctcctgcagccccacaagtacctggaagctcctacccgcctcatatgaag
gtgcttcttccagctctctcacccaccatgactatgggcaccgtgcagcgctgggagaag
aaagtaggtgagaagctgagtgagggagacctgctggctgaaatcgagacagataaggca
acaatcggttttgaggttcaggaggaaggctacctggctaagatcatgatttctgagggc
accagagacgttcctctcggtactccgctctgtatcatcgtggaaaaggaatcagacatt
agtgcatttgcagactatgtagagacaggggttgctgctagcccacctcccgctcccaca
ctggtggccactccaccaccagcagcagctccagcagctcccatcccggcccctgctgct
gctcctgccgctcctgctgctgctaggaaaggaagggtgtttgccagtcctttagccaag
aagctggcagctgagaagggagttgacatcactcaagtcactggaactggaccagatggc
agagtcaccaagaaagatattgacagttttgttccaccaaagctcactcctgctgcagct
gctgccccgtctgcacccacccccagtcctcctgctgcccctgcttatgctgctgtacct
actggaaccttcacggacgtccctatcagcaatatccgcaaagtgattgcccagaggttg
atgcagtcaaaacagactattcctcactattatctgtctatcgatgtcaacatggaccaa
gttcttgaactcaggaaagagctcaatgctgaggtgaaagctgaaaacatcaaactctcg
gtcaatgacttcatcatcaaggcctcggctctagcctgtttaaaggtgccggaggccaat
tcctcttggatggacacagtcataagacaaaatcacgtggtggatgttagtgtggcggtc
agcacgcctgttggtctcatcactcccattgtatttaatgctcatattaagggccttgca
aatatcagcaaagacgtctccgcgttagctgctaaagcacgagatgggaaactacaacct
catgaattccagggtggaaccttcactatttccaatctgggcatgtatggcatcaagcat
ttttcagctatcattaatcctcctcaagcctgcattctggctgtgggtggctcagaaaag
agactgctgcctgcggacaatgaaaaagggtttgacgtggctaacatgatgtctgtgact
ctgagctgcgatcaccgggtggttgatggtgctgttggcgctcaatggctggcagagttt
cgcaagttcctagagaaaccatttaccatgcttctgtga

DBGET integrated database retrieval system