KEGG   Danio rerio (zebrafish): 324254Help
Entry
324254            CDS       T01004                                 

Gene name
mtor, frap1, tor, wu:fc22h08
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dre  Danio rerio (zebrafish)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 2515 aa AA seqDB search
MSGTATVLQQFVSGLKSRNEDTRAKAAKDLQHYVTTELRELSQDEATTFYDELNHHIFEL
VSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMGHLS
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNI
FYAVWDSKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAKEKG
MNKDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFSTKPRHIT
PFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGAAPVPSKSTLVESRYCRELMEERFDQVC
RWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLQDTMGHLLGCLKKEKERTAAFQ
ALGLLVVAVRADIQPYLSKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRAMGP
SIQQDVKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAYQLSSPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLLSGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFWPKMLI
QILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVIC
VLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVEP
YRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSL
SESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVTF
IFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFTL
IREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSVGRNVTIKLL
MAIQLFGANLDDYLHLLLPPVVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASRIIH
PIVRTLDVTPELRNSSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLICRIV
KGYTLAEEEEDPLIFQHRQLRSSQSDTLVSGPVESGPMKKLHVSTTALQKAWGAARKVSK
DDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHEWE
DALVAYDKKIDMNKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVSEETQAKMARMAA
AAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQRIL
MVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVT
YAYMKYMWKSTRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEW
QLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKL
RHASGASANSEASNSDSEADSTEHSPVPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISL
SRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVG
RLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSE
ELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAY
GRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR
DLELAVPGTYDPNQSIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQ
DERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYR
EKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWF
DRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEK
IPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDT
NTKGNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALN
KKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7548 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcactgccacagttctgcagcagtttgtgagtggcctgaagagtcgcaatgaa
gacactcgtgccaaagctgccaaagaccttcagcactacgtcacgacagaactaagagag
ctgagccaagatgaagccaccactttctacgatgaactgaaccaccacatttttgagttg
gtttccagctcagatgtgaatgagaaaaaaggcggtatccttgccatagtgagcctgatt
ggagtggagggaggaaatgccacccgtatcagccgctttgccaactatttgcggaacctg
cttccgtccagtgactcagtggtcatggagatggcctctaaagccatgggtcacctgtcc
atggcgggagacaccttcactgcagagtatgtggagtttgaggtgaagagagctctggag
tggctgggagcagacaggaatgaaggcagacgacatgcagcggtgctggtgttacgagaa
ctggctgtcagcgcacctacattctttttccagcaggtgcagccattctttgataacatt
ttttatgcagtgtgggactccaaacaggccattcgtgagggcgcagtatctgctctcaga
gcttgtttgatccttaccactcagagagagaccaaagagatgcagaaaccacagtggtac
aagcaaacatttgaggaagccgagaagggttttgatgagactttggcgaaagagaaaggg
atgaataaggatgatcgtgtacatggagctctactgattctcaatgagctagtgcgaata
agcagtatggagggagagcgtatgagagaggagatggaggagatcacgcagcagcagttg
gttcatgataagtactgtaaggagttgatgggtttcagcactaagcctcgtcacatcacg
cccttcaccagttttcagtccgttcagccgcagcagtctaacgctctgctggggctgctg
ggttacagcacacctcagggcttcttaagttttggagctgcacctgttccctcgaaaagc
acactggtggagagccgctactgcagagaactgatggaggagcgctttgaccaggtgtgc
cgttgggtgctgaaatacaggaccagtaagaatcctctaatccagatgacaatcttaaac
ctactgcctcgacttgctgccttccagcctcacactttcactgatcagtatttgcaggac
actatggggcacctgctgggctgcctaaaaaaagaaaaggagcggacggcagcatttcaa
gcgctggggctactggtggtggctgtgagggctgatattcagccatacctaagcaagatc
ctggagattatcaaagctgcattgccaccgaaagactttgcgcacaagaggcagaagacc
atgcaggtggatgctactgtatttacttgcataagtatgctgtccagagctatggggcct
agcatccaacaggacgtcaaagaacttctggagcccatgctagctgttggtctcagccct
gctttgactgcagtgctttacgacctgagcaggcagatcccacagctgaagaaggacatt
caggatggtctgctaaagatgctttcacttgtgctcatgcacaagcctcttcgtcacccg
ggtatgcccaagggcctggcgtatcagctgtcatcgcccagcctgaccaacatccctgag
gctagcgacgtgggcagcataactctggcactgagaactctcggcagctttgaatttgaa
ggccactccttgacccagtttgtgcgtcactgtgcggaccactttttgaacagcgagcac
aaggagatccgcatggaggcggcgcgcacctgctcacgtctgcttaccccctccatccac
ctgctcagcggacatggacacgtggtcagtcagactgctgtgcaggtggtggctgacgtt
ctcagcaagctacttgtggttggcatcactgacccagaccctgatattcgatactgtgtg
ctggcctccctggacgaacgctttgatgcccacctggcacaagcagagaacctccaggct
ctgtttgtggcgctgaatgatgaagtgtttgagatccgcgaactggccatctgcaccatc
ggtcgactcagcagtatgaaccctgcctttgtcatgcccttctggcccaagatgctcatt
cagattctgactgagctggaacatagcggtgtgggccgaaacaaagagcagagtgcccgc
atgctgggtcacttggtttccaatgctcccagacttattcgcccatacatggagcccatt
ctcaaggccctcattttaaagctgaaagatcccgatccaaaccctggagttgtcatctgt
gttttagctactattggagaacttgcccaggtgagtggactggagatgaggaaatggatg
gatgagctgttcccaatcattatggacatgctgcaggactcatcttcattagccaagaga
caggtggcactttggactctgggccaacaagtagccagcactgggtatgtggtggagcct
tacaggaagtatccatctctactggaggtgctgctcaacttcctgaagacagaacaaaac
caggggatcaggagagaggccattcgtgttctaggtctgctaggagctctggatccctac
aaacacaaagtgaacatcggaatgatcgaccagtctcgagatgcttctgccgtcagcctc
tccgagtccaagtccagccaggattcagctgactacagcaccagcgagatgctggtcaac
atgggcaacctgccgctagacgagttttacccagcagtcgccatagtgaccctgatgcgt
atcctgcgtgacccgtcgctgtccaatcaccacaccatggtcgttcaggccgtgaccttc
attttcaaatctcttggcctcaaatgtgtgcagttcctgcctcaggtcatgcccaccttt
ctcaacgtcatcagagtgtgtgatgccagcatcagagagtttcttttccagcaaatgggg
atggttgtgtgcttcgtcaaaatccacatccggccctacatggatgatatcttcacacta
atccgggaatactggactccaaacaaccctatgcagaacaccatcattttgctgattgag
cagattgttgtggctctcggtggagaattcaaactctaccttccacagctcatcccacac
atgctgcgagtcttcatgcacgacatgagtgttggacgcaatgtcaccatcaagttactc
atggccatccaactgttcggagctaacctggatgactatctccacctgctgctgcctcct
gtagtgaaactgttcgatgccccggatgtccctctgcaagcccgcaaggttgctttggag
actttagatcgcctgactgaatcgttggacttcacggattatgcctccagaattatccac
cccattgttcgcactcttgatgttactccagagctgaggaactcctccatggacacactg
tcctcgctggtcttccagcttggtaaaaagtatcagatcttcattcctatggtgaacaaa
gtgatgttgaaacaccgcatcaatcaccagcgctatgatgttctcatctgtcgtatcgtc
aagggatatactttggccgaagaggaagaggaccctttaatatttcagcacagacaattg
cgtagtagtcaaagcgacacactggtcagtggcccagtggaatctggacctatgaagaag
ctgcacgtcagcacaactgctcttcagaaggcatggggtgcagccagaaaggtgtccaaa
gatgactggctggagtggttgagaagacttagtgtggtcttgctaaaggaatcctcctca
ccagccctgcgctcctgctggtctctagcacagacatatataccactggctagggatctt
ttcaatgctgcattcttatcgtgctggtccgagctgagtgaagaccagcaggatgagctg
atccgcagtattgagcttgctctgacatctcaggatattgctgaggtcacacagacactg
ctcaacctcgcagaattcatggagcacagcgataagggcccacttcctttgagagatgac
aatgggatagttctgctgggggagagagctgctaaatgtcgggcctacgccaaagccctg
cactacaaggagctggagtttcaaaagggggcttcaccgctcattttagaatctctgatc
agcatcaataataagctccagcagccagaggccgcatcaggagtgctggagtatgccatg
aaacactttggagaattggagatccaggccacctggtatgagaaacttcatgagtgggaa
gatgctctggttgcctacgataaaaaaatcgacatgaacaaagacgatccagagcttatt
ttgggtcgcatgagatgtctggaagcactaggcgaatggggtcagcttcaccaacagtgc
tgtgaggagtggactctggtcagtgaagaaactcaagccaagatggcccgcatggcagca
gctgcggcgtggggactgggccactgggacagtatggaagagtatacctgcatgatcccg
cgagacacccacgatggagccttttaccgggcagtgcttgctttacatcaggatctgttt
tcattggctcagcagtgtattgacaaggccagagatctgctggatgccgagctcaccgcc
atggctggagagagttacagtagagcatacggggctatggtatcatgccagatgctttcg
gagttagaggaggtgatccagtataaactggttcctgagagaagggacatcatcagggaa
acatggtgggagagactgcagggttgtcaacgcattgtggaagactggcagaggatctta
atggtgcgctctttggtcattaacccacatgaggacatgaggacgtggttgaagtacgcc
agcctctgtggaaaaagtggaagactggcgctggcccataagactctggttctcctgctg
ggtgtggatccctccaaacagctcgaccaccccttgcccaccgcccacccgcatgtcacc
tacgcttacatgaagtacatgtggaagagcactcgcaagatcgatgccttccagcatatg
cagcactttgtgcagggaatgcaacagcaagcacaacatgccatcgcagctgaagaccag
cagcacaagctggagctgcacaaactaatggcacggtgttttctgaagctgggggagtgg
cagctcagccttcagggcatcaatgagagcaccatccctaaagtcttgcagtattacagt
cactcaacggagcatgatcgcaactggtacaaggcctggcatgcttgggcagtaatgaac
tttgaggccgtgcttcactacaagcatcagaaccagggccgcgatgagaagaagaaactg
cgacacgcaagcggcgccagcgccaacagcgaagccagtaacagcgacagcgaagccgac
agcaccgagcacagtcccgtaccctcacccggacagaagaaagtcaacgaagatttgtcc
aagactctccttctttacacagtgcctgcagtgcaggggtttttcagatccatctcactc
tcacgtggaaataacttacaggacacactgagagtcctgaccttatggtttgattatggt
cactggcctgaagtgaatgaagctctagtcgaaggtatcaagaccattcagatagacact
tggttacaggtgattcctcaactgatcgctcggattgatacgccacgtgcactggtggga
cggctcattcaccagctactcactgacatcggtcgctaccaccctcaggctttgatttat
cctctcaccgtggcctccaaatccacaaccactgcccgtcacaacgcagccaacaagatc
ttgaagaacatgtgtgagcactgcaacacgctggtccagcaagctattatggtgagcgag
gagcttatcagggtcgctattctctggcatgaaatgtggcacgaggggctggaggaagcg
tcacgtctatattttggagagaggaacgtcaagggaatgtttgccgttctggagcccctc
catgccatgatggagagaggaccacaaaccctaaaagaaacatcatttaatcaggcttat
ggccgagatctgatggaggcgcaggactggtgtagaaagtacatgcgatcgggtaacgtc
aaggacctgacgcaggcgtgggatctgtactaccatgtgttccgcaggatctccaaacag
ctgccacagctcacttctctagagcttcagtacgtctcacctaaactgctgatgtgtcgt
gatttggagttggctgtgcctggaacatatgaccccaatcagtcaatcatacgcatccag
tccattgctccctcgctgcaggtcatcacctccaaacagcggccacgcaaactcaccatc
atgggcagcaatggccatgagttcatgttcctgctgaagggtcatgaagatttacgacag
gacgagagggtcatgcagctttttggcttggtgaacactctactggctaatgacccagcc
tccctgcgcaagaacctgagtattcagcgctatgctgtgatcccgctttccaccaactct
ggcctgattggctgggttcctcactgtgacacgctgcacgcactgattcgagactacaga
gagaagaagaagatcctgctcaacattgaacatcgcatcatgctcaggatggcccctgac
tatgaccatttgactctaatggagaaggtggaagtgtttgagcatgcagtgaacaatact
gcaggagatgacctggccaaactgctttggctgaagagtcccagttcagaggtctggttt
gacaggaggaccaactacacacgctcgctagctgttatgtccatggttggctatatctta
ggacttggagacaggcatccttctaatctgatgttggacaggctcagtggaaagatactg
catatcgattttggagactgttttgaggttgcaatgaccagagaaaaattcccagagaaa
attccttttagattaactcgcatgttaaccaatgccatggaggtgacgggactggatggt
aactaccgtatcacatgccacacagtgatggaggtactccgggaacacagggacagtgtc
atggctgtgctggaggcctttgtctatgacccgttactcaactggaggcttatggacaca
aacactaaaggaaataagcgatcccggaccagaactgactcctatacggcaggacagtct
gtcgaagccatggagggtattgacctgggagaaacaacgcacaaaaagcctggaactacc
gtgcctgagtccattcactctttcattggagacggccttgtgcaacctgaagccttgaac
aagaaagccattcagatcatcaaccgagtgcgggacaagttaactggtcgagatttttcc
catgatgagactctggacgtaccaacacaagtggagctgctcattaagcaagctacgtca
catgaaaacctgtgccaatgctacattggatggtgccctttttggtag

DBGET integrated database retrieval system