KEGG   Danio rerio (zebrafish): 324254Help
Entry
324254            CDS       T01004                                 

Gene name
mtor, frap1, tor, wu:fc22h08
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dre  Danio rerio (zebrafish)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    324254 (mtor)
   04150 mTOR signaling pathway
    324254 (mtor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    324254 (mtor)
   04920 Adipocytokine signaling pathway
    324254 (mtor)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   324254 (mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 2515 aa AA seqDB search
MSGTATVLQQFVSGLKSRNEDTRAKAAKDLQHYVTTELRELSQDEATTFYDELNHHIFEL
VSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMGHLS
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNI
FYAVWDSKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAKEKG
MNKDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFSTKPRHIT
PFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGAAPVPSKSTLVESRYCRELMEERFDQVC
RWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLQDTMGHLLGCLKKEKERTAAFQ
ALGLLVVAVRADIQPYLSKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRAMGP
SIQQDVKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAYQLSSPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLLSGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFWPKMLI
QILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVIC
VLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVEP
YRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSL
SESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVTF
IFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFTL
IREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSVGRNVTIKLL
MAIQLFGANLDDYLHLLLPPVVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASRIIH
PIVRTLDVTPELRNSSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLICRIV
KGYTLAEEEEDPLIFQHRQLRSSQSDTLVSGPVESGPMKKLHVSTTALQKAWGAARKVSK
DDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHEWE
DALVAYDKKIDMNKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVSEETQAKMARMAA
AAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQRIL
MVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVT
YAYMKYMWKSTRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEW
QLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKL
RHASGASANSEASNSDSEADSTEHSPVPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISL
SRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVG
RLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSE
ELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAY
GRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR
DLELAVPGTYDPNQSIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQ
DERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYR
EKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWF
DRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEK
IPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDT
NTKGNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALN
KKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7548 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcactgccacagttctgcagcagtttgtgagtggcctgaagagtcgcaatgaa
gacactcgtgccaaagctgccaaagaccttcagcactacgtcacgacagaactaagagag
ctgagccaagatgaagccaccactttctacgatgaactgaaccaccacatttttgagttg
gtttccagctcagatgtgaatgagaaaaaaggcggtatccttgccatagtgagcctgatt
ggagtggagggaggaaatgccacccgtatcagccgctttgccaactatttgcggaacctg
cttccgtccagtgactcagtggtcatggagatggcctctaaagccatgggtcacctgtcc
atggcgggagacaccttcactgcagagtatgtggagtttgaggtgaagagagctctggag
tggctgggagcagacaggaatgaaggcagacgacatgcagcggtgctggtgttacgagaa
ctggctgtcagcgcacctacattctttttccagcaggtgcagccattctttgataacatt
ttttatgcagtgtgggactccaaacaggccattcgtgagggcgcagtatctgctctcaga
gcttgtttgatccttaccactcagagagagaccaaagagatgcagaaaccacagtggtac
aagcaaacatttgaggaagccgagaagggttttgatgagactttggcgaaagagaaaggg
atgaataaggatgatcgtgtacatggagctctactgattctcaatgagctagtgcgaata
agcagtatggagggagagcgtatgagagaggagatggaggagatcacgcagcagcagttg
gttcatgataagtactgtaaggagttgatgggtttcagcactaagcctcgtcacatcacg
cccttcaccagttttcagtccgttcagccgcagcagtctaacgctctgctggggctgctg
ggttacagcacacctcagggcttcttaagttttggagctgcacctgttccctcgaaaagc
acactggtggagagccgctactgcagagaactgatggaggagcgctttgaccaggtgtgc
cgttgggtgctgaaatacaggaccagtaagaatcctctaatccagatgacaatcttaaac
ctactgcctcgacttgctgccttccagcctcacactttcactgatcagtatttgcaggac
actatggggcacctgctgggctgcctaaaaaaagaaaaggagcggacggcagcatttcaa
gcgctggggctactggtggtggctgtgagggctgatattcagccatacctaagcaagatc
ctggagattatcaaagctgcattgccaccgaaagactttgcgcacaagaggcagaagacc
atgcaggtggatgctactgtatttacttgcataagtatgctgtccagagctatggggcct
agcatccaacaggacgtcaaagaacttctggagcccatgctagctgttggtctcagccct
gctttgactgcagtgctttacgacctgagcaggcagatcccacagctgaagaaggacatt
caggatggtctgctaaagatgctttcacttgtgctcatgcacaagcctcttcgtcacccg
ggtatgcccaagggcctggcgtatcagctgtcatcgcccagcctgaccaacatccctgag
gctagcgacgtgggcagcataactctggcactgagaactctcggcagctttgaatttgaa
ggccactccttgacccagtttgtgcgtcactgtgcggaccactttttgaacagcgagcac
aaggagatccgcatggaggcggcgcgcacctgctcacgtctgcttaccccctccatccac
ctgctcagcggacatggacacgtggtcagtcagactgctgtgcaggtggtggctgacgtt
ctcagcaagctacttgtggttggcatcactgacccagaccctgatattcgatactgtgtg
ctggcctccctggacgaacgctttgatgcccacctggcacaagcagagaacctccaggct
ctgtttgtggcgctgaatgatgaagtgtttgagatccgcgaactggccatctgcaccatc
ggtcgactcagcagtatgaaccctgcctttgtcatgcccttctggcccaagatgctcatt
cagattctgactgagctggaacatagcggtgtgggccgaaacaaagagcagagtgcccgc
atgctgggtcacttggtttccaatgctcccagacttattcgcccatacatggagcccatt
ctcaaggccctcattttaaagctgaaagatcccgatccaaaccctggagttgtcatctgt
gttttagctactattggagaacttgcccaggtgagtggactggagatgaggaaatggatg
gatgagctgttcccaatcattatggacatgctgcaggactcatcttcattagccaagaga
caggtggcactttggactctgggccaacaagtagccagcactgggtatgtggtggagcct
tacaggaagtatccatctctactggaggtgctgctcaacttcctgaagacagaacaaaac
caggggatcaggagagaggccattcgtgttctaggtctgctaggagctctggatccctac
aaacacaaagtgaacatcggaatgatcgaccagtctcgagatgcttctgccgtcagcctc
tccgagtccaagtccagccaggattcagctgactacagcaccagcgagatgctggtcaac
atgggcaacctgccgctagacgagttttacccagcagtcgccatagtgaccctgatgcgt
atcctgcgtgacccgtcgctgtccaatcaccacaccatggtcgttcaggccgtgaccttc
attttcaaatctcttggcctcaaatgtgtgcagttcctgcctcaggtcatgcccaccttt
ctcaacgtcatcagagtgtgtgatgccagcatcagagagtttcttttccagcaaatgggg
atggttgtgtgcttcgtcaaaatccacatccggccctacatggatgatatcttcacacta
atccgggaatactggactccaaacaaccctatgcagaacaccatcattttgctgattgag
cagattgttgtggctctcggtggagaattcaaactctaccttccacagctcatcccacac
atgctgcgagtcttcatgcacgacatgagtgttggacgcaatgtcaccatcaagttactc
atggccatccaactgttcggagctaacctggatgactatctccacctgctgctgcctcct
gtagtgaaactgttcgatgccccggatgtccctctgcaagcccgcaaggttgctttggag
actttagatcgcctgactgaatcgttggacttcacggattatgcctccagaattatccac
cccattgttcgcactcttgatgttactccagagctgaggaactcctccatggacacactg
tcctcgctggtcttccagcttggtaaaaagtatcagatcttcattcctatggtgaacaaa
gtgatgttgaaacaccgcatcaatcaccagcgctatgatgttctcatctgtcgtatcgtc
aagggatatactttggccgaagaggaagaggaccctttaatatttcagcacagacaattg
cgtagtagtcaaagcgacacactggtcagtggcccagtggaatctggacctatgaagaag
ctgcacgtcagcacaactgctcttcagaaggcatggggtgcagccagaaaggtgtccaaa
gatgactggctggagtggttgagaagacttagtgtggtcttgctaaaggaatcctcctca
ccagccctgcgctcctgctggtctctagcacagacatatataccactggctagggatctt
ttcaatgctgcattcttatcgtgctggtccgagctgagtgaagaccagcaggatgagctg
atccgcagtattgagcttgctctgacatctcaggatattgctgaggtcacacagacactg
ctcaacctcgcagaattcatggagcacagcgataagggcccacttcctttgagagatgac
aatgggatagttctgctgggggagagagctgctaaatgtcgggcctacgccaaagccctg
cactacaaggagctggagtttcaaaagggggcttcaccgctcattttagaatctctgatc
agcatcaataataagctccagcagccagaggccgcatcaggagtgctggagtatgccatg
aaacactttggagaattggagatccaggccacctggtatgagaaacttcatgagtgggaa
gatgctctggttgcctacgataaaaaaatcgacatgaacaaagacgatccagagcttatt
ttgggtcgcatgagatgtctggaagcactaggcgaatggggtcagcttcaccaacagtgc
tgtgaggagtggactctggtcagtgaagaaactcaagccaagatggcccgcatggcagca
gctgcggcgtggggactgggccactgggacagtatggaagagtatacctgcatgatcccg
cgagacacccacgatggagccttttaccgggcagtgcttgctttacatcaggatctgttt
tcattggctcagcagtgtattgacaaggccagagatctgctggatgccgagctcaccgcc
atggctggagagagttacagtagagcatacggggctatggtatcatgccagatgctttcg
gagttagaggaggtgatccagtataaactggttcctgagagaagggacatcatcagggaa
acatggtgggagagactgcagggttgtcaacgcattgtggaagactggcagaggatctta
atggtgcgctctttggtcattaacccacatgaggacatgaggacgtggttgaagtacgcc
agcctctgtggaaaaagtggaagactggcgctggcccataagactctggttctcctgctg
ggtgtggatccctccaaacagctcgaccaccccttgcccaccgcccacccgcatgtcacc
tacgcttacatgaagtacatgtggaagagcactcgcaagatcgatgccttccagcatatg
cagcactttgtgcagggaatgcaacagcaagcacaacatgccatcgcagctgaagaccag
cagcacaagctggagctgcacaaactaatggcacggtgttttctgaagctgggggagtgg
cagctcagccttcagggcatcaatgagagcaccatccctaaagtcttgcagtattacagt
cactcaacggagcatgatcgcaactggtacaaggcctggcatgcttgggcagtaatgaac
tttgaggccgtgcttcactacaagcatcagaaccagggccgcgatgagaagaagaaactg
cgacacgcaagcggcgccagcgccaacagcgaagccagtaacagcgacagcgaagccgac
agcaccgagcacagtcccgtaccctcacccggacagaagaaagtcaacgaagatttgtcc
aagactctccttctttacacagtgcctgcagtgcaggggtttttcagatccatctcactc
tcacgtggaaataacttacaggacacactgagagtcctgaccttatggtttgattatggt
cactggcctgaagtgaatgaagctctagtcgaaggtatcaagaccattcagatagacact
tggttacaggtgattcctcaactgatcgctcggattgatacgccacgtgcactggtggga
cggctcattcaccagctactcactgacatcggtcgctaccaccctcaggctttgatttat
cctctcaccgtggcctccaaatccacaaccactgcccgtcacaacgcagccaacaagatc
ttgaagaacatgtgtgagcactgcaacacgctggtccagcaagctattatggtgagcgag
gagcttatcagggtcgctattctctggcatgaaatgtggcacgaggggctggaggaagcg
tcacgtctatattttggagagaggaacgtcaagggaatgtttgccgttctggagcccctc
catgccatgatggagagaggaccacaaaccctaaaagaaacatcatttaatcaggcttat
ggccgagatctgatggaggcgcaggactggtgtagaaagtacatgcgatcgggtaacgtc
aaggacctgacgcaggcgtgggatctgtactaccatgtgttccgcaggatctccaaacag
ctgccacagctcacttctctagagcttcagtacgtctcacctaaactgctgatgtgtcgt
gatttggagttggctgtgcctggaacatatgaccccaatcagtcaatcatacgcatccag
tccattgctccctcgctgcaggtcatcacctccaaacagcggccacgcaaactcaccatc
atgggcagcaatggccatgagttcatgttcctgctgaagggtcatgaagatttacgacag
gacgagagggtcatgcagctttttggcttggtgaacactctactggctaatgacccagcc
tccctgcgcaagaacctgagtattcagcgctatgctgtgatcccgctttccaccaactct
ggcctgattggctgggttcctcactgtgacacgctgcacgcactgattcgagactacaga
gagaagaagaagatcctgctcaacattgaacatcgcatcatgctcaggatggcccctgac
tatgaccatttgactctaatggagaaggtggaagtgtttgagcatgcagtgaacaatact
gcaggagatgacctggccaaactgctttggctgaagagtcccagttcagaggtctggttt
gacaggaggaccaactacacacgctcgctagctgttatgtccatggttggctatatctta
ggacttggagacaggcatccttctaatctgatgttggacaggctcagtggaaagatactg
catatcgattttggagactgttttgaggttgcaatgaccagagaaaaattcccagagaaa
attccttttagattaactcgcatgttaaccaatgccatggaggtgacgggactggatggt
aactaccgtatcacatgccacacagtgatggaggtactccgggaacacagggacagtgtc
atggctgtgctggaggcctttgtctatgacccgttactcaactggaggcttatggacaca
aacactaaaggaaataagcgatcccggaccagaactgactcctatacggcaggacagtct
gtcgaagccatggagggtattgacctgggagaaacaacgcacaaaaagcctggaactacc
gtgcctgagtccattcactctttcattggagacggccttgtgcaacctgaagccttgaac
aagaaagccattcagatcatcaaccgagtgcgggacaagttaactggtcgagatttttcc
catgatgagactctggacgtaccaacacaagtggagctgctcattaagcaagctacgtca
catgaaaacctgtgccaatgctacattggatggtgccctttttggtag

DBGET integrated database retrieval system