KEGG   Danio rerio (zebrafish): 324254Help
Entry
324254            CDS       T01004                                 

Gene name
mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04136  Autophagy - other
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04218  Cellular senescence
dre04371  Apelin signaling pathway
dre04910  Insulin signaling pathway
dre04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    324254 (mtor)
   04371 Apelin signaling pathway
    324254 (mtor)
   04150 mTOR signaling pathway
    324254 (mtor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    324254 (mtor)
   04136 Autophagy - other eukaryotes
    324254 (mtor)
  Cell growth and death
   04218 Cellular senescence
    324254 (mtor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    324254 (mtor)
   04920 Adipocytokine signaling pathway
    324254 (mtor)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     324254 (mtor)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   324254 (mtor)
Membrane trafficking [BR:dre04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    324254 (mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 324254
NCBI-ProteinID: NP_001070679
ZFIN: ZDB-GENE-030131-2974
Ensembl: ENSDARG00000053196
Vega: OTTDARG00000026928
UniProt: Q06RG6
Position
8
AA seq 2515 aa AA seqDB search
MSGTATVLQQFVSGLKSRNEDTRAKAAKDLQHYVTTELRELSQDEATTFYDELNHHIFEL
VSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMGHLS
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNI
FYAVWDSKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAKEKG
MNKDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFSTKPRHIT
PFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGAAPVPSKSTLVESRYCRELMEERFDQVC
RWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLQDTMGHLLGCLKKEKERTAAFQ
ALGLLVVAVRADIQPYLSKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRAMGP
SIQQDVKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAYQLSSPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLLSGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFWPKMLI
QILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVIC
VLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVEP
YRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSL
SESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVTF
IFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFTL
IREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSVGRNVTIKLL
MAIQLFGANLDDYLHLLLPPVVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASRIIH
PIVRTLDVTPELRNSSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLICRIV
KGYTLAEEEEDPLIFQHRQLRSSQSDTLVSGPVESGPMKKLHVSTTALQKAWGAARKVSK
DDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHEWE
DALVAYDKKIDMNKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVSEETQAKMARMAA
AAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQRIL
MVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVT
YAYMKYMWKSTRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEW
QLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKL
RHASGASANSEASNSDSEADSTEHSPVPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISL
SRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVG
RLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSE
ELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAY
GRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR
DLELAVPGTYDPNQSIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQ
DERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYR
EKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWF
DRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEK
IPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDT
NTKGNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALN
KKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7548 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcactgccacagttctgcagcagtttgtgagtggcctgaagagtcgcaatgaa
gacactcgtgccaaagctgccaaagaccttcagcactacgtcacgacagaactaagagag
ctgagccaagatgaagccaccactttctacgatgaactgaaccaccacatttttgagttg
gtttccagctcagatgtgaatgagaaaaaaggcggtatccttgccatagtgagcctgatt
ggagtggagggaggaaatgccacccgtatcagccgctttgccaactatttgcggaacctg
cttccgtccagtgactcagtggtcatggagatggcctctaaagccatgggtcacctgtcc
atggcgggagacaccttcactgcagagtatgtggagtttgaggtgaagagagctctggag
tggctgggagcagacaggaatgaaggcagacgacatgcagcggtgctggtgttacgagaa
ctggctgtcagcgcacctacattctttttccagcaggtgcagccattctttgataacatt
ttttatgcagtgtgggactccaaacaggccattcgtgagggcgcagtatctgctctcaga
gcttgtttgatccttaccactcagagagagaccaaagagatgcagaaaccacagtggtac
aagcaaacatttgaggaagccgagaagggttttgatgagactttggcgaaagagaaaggg
atgaataaggatgatcgtgtacatggagctctactgattctcaatgagctagtgcgaata
agcagtatggagggagagcgtatgagagaggagatggaggagatcacgcagcagcagttg
gttcatgataagtactgtaaggagttgatgggtttcagcactaagcctcgtcacatcacg
cccttcaccagttttcagtccgttcagccgcagcagtctaacgctctgctggggctgctg
ggttacagcacacctcagggcttcttaagttttggagctgcacctgttccctcgaaaagc
acactggtggagagccgctactgcagagaactgatggaggagcgctttgaccaggtgtgc
cgttgggtgctgaaatacaggaccagtaagaatcctctaatccagatgacaatcttaaac
ctactgcctcgacttgctgccttccagcctcacactttcactgatcagtatttgcaggac
actatggggcacctgctgggctgcctaaaaaaagaaaaggagcggacggcagcatttcaa
gcgctggggctactggtggtggctgtgagggctgatattcagccatacctaagcaagatc
ctggagattatcaaagctgcattgccaccgaaagactttgcgcacaagaggcagaagacc
atgcaggtggatgctactgtatttacttgcataagtatgctgtccagagctatggggcct
agcatccaacaggacgtcaaagaacttctggagcccatgctagctgttggtctcagccct
gctttgactgcagtgctttacgacctgagcaggcagatcccacagctgaagaaggacatt
caggatggtctgctaaagatgctttcacttgtgctcatgcacaagcctcttcgtcacccg
ggtatgcccaagggcctggcgtatcagctgtcatcgcccagcctgaccaacatccctgag
gctagcgacgtgggcagcataactctggcactgagaactctcggcagctttgaatttgaa
ggccactccttgacccagtttgtgcgtcactgtgcggaccactttttgaacagcgagcac
aaggagatccgcatggaggcggcgcgcacctgctcacgtctgcttaccccctccatccac
ctgctcagcggacatggacacgtggtcagtcagactgctgtgcaggtggtggctgacgtt
ctcagcaagctacttgtggttggcatcactgacccagaccctgatattcgatactgtgtg
ctggcctccctggacgaacgctttgatgcccacctggcacaagcagagaacctccaggct
ctgtttgtggcgctgaatgatgaagtgtttgagatccgcgaactggccatctgcaccatc
ggtcgactcagcagtatgaaccctgcctttgtcatgcccttctggcccaagatgctcatt
cagattctgactgagctggaacatagcggtgtgggccgaaacaaagagcagagtgcccgc
atgctgggtcacttggtttccaatgctcccagacttattcgcccatacatggagcccatt
ctcaaggccctcattttaaagctgaaagatcccgatccaaaccctggagttgtcatctgt
gttttagctactattggagaacttgcccaggtgagtggactggagatgaggaaatggatg
gatgagctgttcccaatcattatggacatgctgcaggactcatcttcattagccaagaga
caggtggcactttggactctgggccaacaagtagccagcactgggtatgtggtggagcct
tacaggaagtatccatctctactggaggtgctgctcaacttcctgaagacagaacaaaac
caggggatcaggagagaggccattcgtgttctaggtctgctaggagctctggatccctac
aaacacaaagtgaacatcggaatgatcgaccagtctcgagatgcttctgccgtcagcctc
tccgagtccaagtccagccaggattcagctgactacagcaccagcgagatgctggtcaac
atgggcaacctgccgctagacgagttttacccagcagtcgccatagtgaccctgatgcgt
atcctgcgtgacccgtcgctgtccaatcaccacaccatggtcgttcaggccgtgaccttc
attttcaaatctcttggcctcaaatgtgtgcagttcctgcctcaggtcatgcccaccttt
ctcaacgtcatcagagtgtgtgatgccagcatcagagagtttcttttccagcaaatgggg
atggttgtgtgcttcgtcaaaatccacatccggccctacatggatgatatcttcacacta
atccgggaatactggactccaaacaaccctatgcagaacaccatcattttgctgattgag
cagattgttgtggctctcggtggagaattcaaactctaccttccacagctcatcccacac
atgctgcgagtcttcatgcacgacatgagtgttggacgcaatgtcaccatcaagttactc
atggccatccaactgttcggagctaacctggatgactatctccacctgctgctgcctcct
gtagtgaaactgttcgatgccccggatgtccctctgcaagcccgcaaggttgctttggag
actttagatcgcctgactgaatcgttggacttcacggattatgcctccagaattatccac
cccattgttcgcactcttgatgttactccagagctgaggaactcctccatggacacactg
tcctcgctggtcttccagcttggtaaaaagtatcagatcttcattcctatggtgaacaaa
gtgatgttgaaacaccgcatcaatcaccagcgctatgatgttctcatctgtcgtatcgtc
aagggatatactttggccgaagaggaagaggaccctttaatatttcagcacagacaattg
cgtagtagtcaaagcgacacactggtcagtggcccagtggaatctggacctatgaagaag
ctgcacgtcagcacaactgctcttcagaaggcatggggtgcagccagaaaggtgtccaaa
gatgactggctggagtggttgagaagacttagtgtggtcttgctaaaggaatcctcctca
ccagccctgcgctcctgctggtctctagcacagacatatataccactggctagggatctt
ttcaatgctgcattcttatcgtgctggtccgagctgagtgaagaccagcaggatgagctg
atccgcagtattgagcttgctctgacatctcaggatattgctgaggtcacacagacactg
ctcaacctcgcagaattcatggagcacagcgataagggcccacttcctttgagagatgac
aatgggatagttctgctgggggagagagctgctaaatgtcgggcctacgccaaagccctg
cactacaaggagctggagtttcaaaagggggcttcaccgctcattttagaatctctgatc
agcatcaataataagctccagcagccagaggccgcatcaggagtgctggagtatgccatg
aaacactttggagaattggagatccaggccacctggtatgagaaacttcatgagtgggaa
gatgctctggttgcctacgataaaaaaatcgacatgaacaaagacgatccagagcttatt
ttgggtcgcatgagatgtctggaagcactaggcgaatggggtcagcttcaccaacagtgc
tgtgaggagtggactctggtcagtgaagaaactcaagccaagatggcccgcatggcagca
gctgcggcgtggggactgggccactgggacagtatggaagagtatacctgcatgatcccg
cgagacacccacgatggagccttttaccgggcagtgcttgctttacatcaggatctgttt
tcattggctcagcagtgtattgacaaggccagagatctgctggatgccgagctcaccgcc
atggctggagagagttacagtagagcatacggggctatggtatcatgccagatgctttcg
gagttagaggaggtgatccagtataaactggttcctgagagaagggacatcatcagggaa
acatggtgggagagactgcagggttgtcaacgcattgtggaagactggcagaggatctta
atggtgcgctctttggtcattaacccacatgaggacatgaggacgtggttgaagtacgcc
agcctctgtggaaaaagtggaagactggcgctggcccataagactctggttctcctgctg
ggtgtggatccctccaaacagctcgaccaccccttgcccaccgcccacccgcatgtcacc
tacgcttacatgaagtacatgtggaagagcactcgcaagatcgatgccttccagcatatg
cagcactttgtgcagggaatgcaacagcaagcacaacatgccatcgcagctgaagaccag
cagcacaagctggagctgcacaaactaatggcacggtgttttctgaagctgggggagtgg
cagctcagccttcagggcatcaatgagagcaccatccctaaagtcttgcagtattacagt
cactcaacggagcatgatcgcaactggtacaaggcctggcatgcttgggcagtaatgaac
tttgaggccgtgcttcactacaagcatcagaaccagggccgcgatgagaagaagaaactg
cgacacgcaagcggcgccagcgccaacagcgaagccagtaacagcgacagcgaagccgac
agcaccgagcacagtcccgtaccctcacccggacagaagaaagtcaacgaagatttgtcc
aagactctccttctttacacagtgcctgcagtgcaggggtttttcagatccatctcactc
tcacgtggaaataacttacaggacacactgagagtcctgaccttatggtttgattatggt
cactggcctgaagtgaatgaagctctagtcgaaggtatcaagaccattcagatagacact
tggttacaggtgattcctcaactgatcgctcggattgatacgccacgtgcactggtggga
cggctcattcaccagctactcactgacatcggtcgctaccaccctcaggctttgatttat
cctctcaccgtggcctccaaatccacaaccactgcccgtcacaacgcagccaacaagatc
ttgaagaacatgtgtgagcactgcaacacgctggtccagcaagctattatggtgagcgag
gagcttatcagggtcgctattctctggcatgaaatgtggcacgaggggctggaggaagcg
tcacgtctatattttggagagaggaacgtcaagggaatgtttgccgttctggagcccctc
catgccatgatggagagaggaccacaaaccctaaaagaaacatcatttaatcaggcttat
ggccgagatctgatggaggcgcaggactggtgtagaaagtacatgcgatcgggtaacgtc
aaggacctgacgcaggcgtgggatctgtactaccatgtgttccgcaggatctccaaacag
ctgccacagctcacttctctagagcttcagtacgtctcacctaaactgctgatgtgtcgt
gatttggagttggctgtgcctggaacatatgaccccaatcagtcaatcatacgcatccag
tccattgctccctcgctgcaggtcatcacctccaaacagcggccacgcaaactcaccatc
atgggcagcaatggccatgagttcatgttcctgctgaagggtcatgaagatttacgacag
gacgagagggtcatgcagctttttggcttggtgaacactctactggctaatgacccagcc
tccctgcgcaagaacctgagtattcagcgctatgctgtgatcccgctttccaccaactct
ggcctgattggctgggttcctcactgtgacacgctgcacgcactgattcgagactacaga
gagaagaagaagatcctgctcaacattgaacatcgcatcatgctcaggatggcccctgac
tatgaccatttgactctaatggagaaggtggaagtgtttgagcatgcagtgaacaatact
gcaggagatgacctggccaaactgctttggctgaagagtcccagttcagaggtctggttt
gacaggaggaccaactacacacgctcgctagctgttatgtccatggttggctatatctta
ggacttggagacaggcatccttctaatctgatgttggacaggctcagtggaaagatactg
catatcgattttggagactgttttgaggttgcaatgaccagagaaaaattcccagagaaa
attccttttagattaactcgcatgttaaccaatgccatggaggtgacgggactggatggt
aactaccgtatcacatgccacacagtgatggaggtactccgggaacacagggacagtgtc
atggctgtgctggaggcctttgtctatgacccgttactcaactggaggcttatggacaca
aacactaaaggaaataagcgatcccggaccagaactgactcctatacggcaggacagtct
gtcgaagccatggagggtattgacctgggagaaacaacgcacaaaaagcctggaactacc
gtgcctgagtccattcactctttcattggagacggccttgtgcaacctgaagccttgaac
aagaaagccattcagatcatcaaccgagtgcgggacaagttaactggtcgagatttttcc
catgatgagactctggacgtaccaacacaagtggagctgctcattaagcaagctacgtca
catgaaaacctgtgccaatgctacattggatggtgccctttttggtag

DBGET integrated database retrieval system