KEGG   Danio rerio (zebrafish): 324487Help
Entry
324487            CDS       T01004                                 

Gene name
mgea5, wu:fc30f03
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     324487 (mgea5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     324487 (mgea5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
13
AA seq 909 aa AA seqDB search
MVQKDKIIESSQPEVEVIPVPVEAVADTQCPVDEPTIEIERTGRRKFITGVVEGFYGRPW
TMEQRKELFRRQQKWGLNTYLYAPKDDYKHRMFWREMYSVEEAEQLTTLISAAKEYGIEF
IYAISPGLDITFSNQKEVSTLKRKLDQVTHFGCKSFALLFDDIDHNMCPADKEVFSSFAH
AQVSVTNEIFQYLGEPEIFLFCPTEYCGTFCYPNVSQSPYLRTIGEKLLPGIEVLWTGPK
VVSKDITVESIEEVTKILRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTN
PNCEFESNFVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEELETDIL
YSPQIALKLALTEWLSEFGVPHQYNSRQVPHSGTKSTTMDVPTLAASTLVTSTTVTTVFQ
QPIMSPVLPLSDEPHVLGKEEEEEVEKKESDEEPMEMVVEKHDEVEDTKNVNQILTEIVK
AKMTEDLKPMDTDKESLTESKSPEMSIQEDSGSDIAPMQTDDQLNKEVFVPGPNEKPLFI
TEALTLEDLTLLAELFYLPYEHGPKSVQMLKEFNWLRANSNYVSVNSKAKDPEKVTEWQS
RAENFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMVKSFVQWLGCRSQSSA
QFLSGDQEPWAFRGGLAGEFQRLLPIDGANDLFYQPPPSMPTSKIYTIRPYFAKDESAIY
KICKEMFTESCEGISFSDESPDLIGDRLVGGFLTLSPDYGFVLEDEEGVCGYAMGTVDVK
PFVKKCKLSWIPFMQEKYIKPDAEKDLSEAEKMMLSFHEEEDGLPESFLRNFPSLIKVDI
HAKVTDPSVAKSMMGCLLSSLKANGSHGAFCEVRQIDKRMLDFYSKLGCFEVAKMEGFPK
DIIIMGRSL
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggttcagaaagacaaaataatcgagtcgtcgcagccagaggttgaagttattccagtg
ccagtggaagcggttgcagatacccagtgtccagttgacgagcccaccatcgagattgag
cgaacaggccgcaggaaattcatcaccggtgttgtggagggcttctatggacggccatgg
actatggaacaaaggaaagagcttttcaggaggcagcagaaatggggcttgaacacatat
ttgtatgccccaaaagatgactacaaacacagaatgttttggagagaaatgtattctgtt
gaggaagcagagcaactcacaactttgataagtgctgctaaagagtatgggattgagttc
atttatgccatttctccgggcctggacattactttctcaaatcaaaaggaagtgtcgaca
cttaaaaggaaattagaccaggtcactcattttgggtgcaagtcctttgccttactgttt
gacgacattgatcataacatgtgtccggctgacaaggaggtattcagctcttttgcacat
gcccaagtctctgtcaccaatgagatcttccaatatttgggagaacctgaaatatttttg
ttttgccccacagagtattgtggaacattttgttatccaaatgtgtcacaatcgccttac
ctgcgcacaataggtgaaaagctacttcctggtattgaggtgttatggacaggtcccaaa
gtagtatctaaagacataaccgttgaatcaattgaagaagtcacaaagatactaaggaga
gctcctgtaatctgggacaacatccatgctaatgactatgatcaaaagagacttttcttg
ggaccttataaaggccggtctacagaactcattcctcggctaaaaggagtccttaccaac
cccaactgtgaatttgagtctaattttgtggctattcacacgttagccacatggtataag
tctaacatgaatggagtgaggaaagatgtggtcatgactgacagtgaagacagcactgtg
tccatccagataaagctggaaaacgagggcagtgatgaggagctagaaactgatatcctc
tacagcccacagattgcactcaagctagctctcactgaatggctgagcgagtttggcgtc
cctcatcagtacaacagccggcaagtgcctcacagtggaacaaaaagcactactatggat
gttcccactcttgctgcatccaccctggtcacttccactacagtgaccacagtcttccaa
cagcccatcatgagtccggttttgcccctttctgatgaaccacatgtgcttggcaaagaa
gaagaagaggaggtggagaagaaggagtctgatgaagaacccatggagatggtcgtggag
aaacacgacgaggtggaggacaccaaaaatgtcaaccagattctaacagagatcgtcaaa
gccaagatgacggaagatctcaaacctatggacactgataaagagagcctgacagagtcc
aaatcaccagaaatgtccattcaagaggattcaggcagtgatattgcaccgatgcaaaca
gatgatcagctcaataaggaagtgtttgttcctggccccaacgagaaaccactcttcatt
accgaggcacttactctggaggatctgacgctgctggctgaacttttctacctgccttac
gaacatggtccaaaatcagtacagatgctgaaagagtttaactggttgagagccaatagc
aattatgttagtgtcaactccaaagcaaaggatccagagaaggtaactgagtggcaatcc
agagctgaaaactttgaggagatgtgctgctctgtcatgcagatgttcaccagactctca
aactccgccaacaggaccattctttatgacctgtatccctatatctgggatataaagagt
atcatctcaatggtgaaatcatttgttcagtggttagggtgtcgtagtcagtcgtcagca
cagttcttaagtggcgaccaagagccctgggcctttaggggcggtctagcaggagagttc
cagagactgttgccaattgatggagcaaacgatcttttctaccagccaccgccatcaatg
ccaacttccaaaatctataccataaggccttactttgccaaagatgagtctgccatctat
aagatctgcaaggagatgttcactgagagctgtgagggcatttctttctcagatgaatca
ccggaccttattggagacaggttagtgggaggtttcctgacactcagtccagactatggc
tttgtgcttgaggatgaggaaggtgtgtgtggctatgctatgggcactgtggatgtcaag
cctttcgtgaagaaatgtaagcttagttggattccgttcatgcaggagaaatacatcaag
ccagacgcagagaaggacctttcagaggctgagaaaatgatgctgagttttcatgaggaa
gaagacggtttgccagaatcattcctcaggaacttcccatcactcataaaagtagatatt
cacgcaaaggtcactgaccccagtgttgccaaaagcatgatgggttgtcttctctcatca
ctgaaagctaatggctcacatggtgctttctgtgaggtccggcagattgacaaaaggatg
ttggacttttatagcaaactgggctgctttgaagtggccaagatggagggatttccaaaa
gacattattattatggggaggagtttgtga

DBGET integrated database retrieval system