KEGG   Danio rerio (zebrafish): 324560Help
Entry
324560            CDS       T01004                                 

Gene name
cyb5r3, fc32h03, wu:fc32h03, zgc:77071
Definition
cytochrome b5 reductase 3 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    324560 (cyb5r3)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     324560 (cyb5r3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
4
AA seq 298 aa AA seqDB search
MSFIFNLITGSCQFVLDFLRRLFGFKSRPAITLEDPDVKYPLRLVDKEIISHDTRRFRFA
LKSPDHVLGLPIGQHIYLSAKIDGNLVVRPYTPVSSDDDKGFVDLVVKIYYKNIHPKFPD
GGKMSQYLESLRIGDTIDFRGPSGLLVYKGKGSFAIRPDKKSDAVIKTAKHVGMIAGGTG
ITPMLQIIQAVMKDPKDDTVCYLLFANQTEKDILLRPELEEIMANHPTRFKLWYTVDRAP
DGWEYSQGFINEDMVRKHLPSPGNETLVLMCGPPPMIQFACNPSLDKVGHSNDRRFMF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcatctttaacctcatcactggtagctgtcaattcgtgcttgattttctccga
agactctttggttttaagtcgagaccagccatcacccttgaagatcccgatgtaaaatac
ccattgcgtcttgttgacaaagagattataagccatgacacaagaagatttcgatttgct
ttaaaatcacccgatcatgttcttggacttcctattggtcaacacatctacttgtctgcc
aaaattgatggcaaccttgtggtgaggccttacacgccggtgtctagtgatgatgataag
ggcttcgtggatctagttgtcaagatatactacaaaaatatccatccaaagtttccagac
ggaggcaagatgtcccaatacttggagagccttcgcattggtgacacaattgatttcagg
ggaccaagtggactgctggtttacaaaggcaaaggatcgtttgcaatcaggccagataag
aaatcagacgctgtgataaaaactgctaaacatgttggcatgattgctgggggaacaggc
attactcccatgctccagatcatccaagcagtcatgaaagatccaaaggatgacacagtg
tgttacttactctttgcaaaccagacagaaaaagacattctcctacgccctgagttggag
gagatcatggccaatcacccgacacggtttaagctgtggtacaccgtcgacagagcacca
gacggttgggagtacagtcaaggcttcatcaatgaagacatggtgagaaagcaccttcct
tcacccggaaacgaaacactcgtcttgatgtgtggacctcctcccatgattcagttcgcc
tgcaacccaagtctggacaaggtgggccattccaatgacaggcgcttcatgttctag

DBGET integrated database retrieval system