KEGG   Danio rerio (zebrafish): 325034Help
Entry
325034            CDS       T01004                                 

Gene name
pak2b, wu:fc52b03, zgc:113857
Definition
p21 protein (Cdc42/Rac)-activated kinase 2b
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    325034 (pak2b)
   04012 ErbB signaling pathway
    325034 (pak2b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    325034 (pak2b)
  Cellular commiunity
   04510 Focal adhesion
    325034 (pak2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     325034 (pak2b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   325034 (pak2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 539 aa AA seqDB search
MCDNGDVEDKPPAPPVRMSSTIFSGAKDHALTANHSSKPLPSVPEERKRNKIYSIFSGAE
KGGRRKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGTPEQWARLLQTSNITKSEQKKN
PQAVLDVLKFYDSTGNGRQKYLSFSSEKDSFPSGEQSPAKKTPEPSSPVKAVDDEDNGED
EDDDDDDDEETPPPVVAPRPEHTKSVYTRPSVIDPLPPPVTSPESDAASKATDRQRPKKG
KMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQ
PKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQI
AAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVG
TPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQS
PEKLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKDAMKNNR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgataatggcgatgtggaggacaagccgcccgctccgcctgtcaggatgagcagc
accatcttcagcggcgccaaagaccacgccctcaccgccaatcacagctccaagcccctc
ccatcggtccctgaggagcgcaagcgcaacaagatctactccatcttctccggcgcagag
aaaggtggacgcaggaaggatcgtgataaagagcgtcctgaaatctctccaccgtcagac
ttcgagcacaccattcatgtgggatttgacgccgttactggagagttcactggaacgccg
gagcagtgggctcgattactgcagacctccaacatcaccaagtcggagcagaagaaaaac
ccgcaggccgttctagacgtgctcaagttctacgactccacaggcaacggcagacagaag
tacctcagtttctcctcagagaaggacagctttccctccggtgaacagtcgcctgcaaag
aaaactccagagccgtcgtctccagtcaaagcagtggatgatgaagataatggtgaagat
gaagacgatgatgatgatgatgatgaagaaacgccgccgcctgtcgtagcaccccggcct
gaacacactaagagcgtttacactcgaccgtcggtcatcgacccactccccccgccggtg
acgtctccagaaagtgacgcagcgtcgaaggccactgaccgacagagacccaaaaagggc
aagatgacggacgaggagatcatggacaagctcagaaccatagtcagcattggagacccc
aaaaagaaatacacacgatatgagaagatcggacaaggagcgtcaggaaccgtgttcacc
gcaatagacgtcgccactggacaggaggtggccatcaaacagatcaacctgcagaaacag
cccaagaaagagctgatcatcaacgagatcctcgtcatgaaggagctgaagaatccaaac
atcgtcaacttcttagacagttttcttgtaggtgaggagctgtttgtggtgatggagtat
ttggccggcgggtcgctcaccgatgtcgtaactgagacctgcatggatgaagctcagatc
gccgctgtgtgccgagagtgtttgcaggcgctggagtttcttcatgctaatcaggtcatt
catcgagacatcaagagcgacaacgtgcttctaggaatggacggttctgtcaaactcacg
gacttcggtttctgtgcccagatcactcccgaacagagtaagaggagcacgatggtgggt
acgccgtactggatggctccggaagtggtgacgcgcaaagcctacggacccaaagtggac
atctggtcattgggcatcatggctatcgagatggtggagggagagccgccgtatctcaat
gagaatccactgagggcgctgtacctgattgcaaccaatggcactccagagttgcagagt
cccgaaaagttgtcgccaatcttccgagacttcctaggtcgctgtctggaaatggacgtc
gagaagagaggtggaagcaaagagcttttgcagcatcccttcctgaagttggccaaacct
ctctccagtctcactcctctaattctggccgccaaggacgccatgaagaacaaccgctag

DBGET integrated database retrieval system