KEGG   Danio rerio (zebrafish): 325034Help
Entry
325034            CDS       T01004                                 

Gene name
pak2b, CH73-159L23.1, wu:fc52b03, zgc:113857
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 2b
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    325034 (pak2b)
   04012 ErbB signaling pathway
    325034 (pak2b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    325034 (pak2b)
  Cellular community - eukaryotes
   04510 Focal adhesion
    325034 (pak2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     325034 (pak2b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   325034 (pak2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 539 aa AA seqDB search
MCDNGDVEDKPPAPPVRMSSTIFSGAKDHALTANHSSKPLPSVPEERKRNKIYSIFSGAE
KGGRRKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGTPEQWARLLQTSNITKSEQKKN
PQAVLDVLKFYDSTGNGRQKYLSFSSEKDSFPSGEQSPAKKTPEPSSPVKAVDDEDNGED
EDDDDDDDEETPPPVVAPRPEHTKSVYTRPSVIDPLPPPVTSPESDAASKATDRQRPKKG
KMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQ
PKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQI
AAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVG
TPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQS
PEKLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKDAMKNNR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgataatggcgatgtggaggacaagccgcccgctccgcctgtcaggatgagcagc
accatcttcagcggcgccaaagaccacgccctcaccgccaatcacagctccaagcccctc
ccatcggtccctgaggagcgcaagcgcaacaagatctactccatcttctccggcgcagag
aaaggtggacgcaggaaggatcgtgataaagagcgtcctgaaatctctccaccgtcagac
ttcgagcacaccattcatgtgggatttgacgccgttactggagagttcactggaacgccg
gagcagtgggctcgattactgcagacctccaacatcaccaagtcggagcagaagaaaaac
ccgcaggccgttctagacgtgctcaagttctacgactccacaggcaacggcagacagaag
tacctcagtttctcctcagagaaggacagctttccctccggtgaacagtcgcctgcaaag
aaaactccagagccgtcgtctccagtcaaagcagtggatgatgaagataatggtgaagat
gaagacgatgatgatgatgatgatgaagaaacgccgccgcctgtcgtagcaccccggcct
gaacacactaagagcgtttacactcgaccgtcggtcatcgacccactccccccgccggtg
acgtctccagaaagtgacgcagcgtcgaaggccactgaccgacagagacccaaaaagggc
aagatgacggacgaggagatcatggacaagctcagaaccatagtcagcattggagacccc
aaaaagaaatacacacgatatgagaagatcggacaaggagcgtcaggaaccgtgttcacc
gcaatagacgtcgccactggacaggaggtggccatcaaacagatcaacctgcagaaacag
cccaagaaagagctgatcatcaacgagatcctcgtcatgaaggagctgaagaatccaaac
atcgtcaacttcttagacagttttcttgtaggtgaggagctgtttgtggtgatggagtat
ttggccggcgggtcgctcaccgatgtcgtaactgagacctgcatggatgaagctcagatc
gccgctgtgtgccgagagtgtttgcaggcgctggagtttcttcatgctaatcaggtcatt
catcgagacatcaagagcgacaacgtgcttctaggaatggacggttctgtcaaactcacg
gacttcggtttctgtgcccagatcactcccgaacagagtaagaggagcacgatggtgggt
acgccgtactggatggctccggaagtggtgacgcgcaaagcctacggacccaaagtggac
atctggtcattgggcatcatggctatcgagatggtggagggagagccgccgtatctcaat
gagaatccactgagggcgctgtacctgattgcaaccaatggcactccagagttgcagagt
cccgaaaagttgtcgccaatcttccgagacttcctaggtcgctgtctggaaatggacgtc
gagaagagaggtggaagcaaagagcttttgcagcatcccttcctgaagttggccaaacct
ctctccagtctcactcctctaattctggccgccaaggacgccatgaagaacaaccgctag

DBGET integrated database retrieval system