KEGG   Danio rerio (zebrafish): 325119Help
Entry
325119            CDS       T01004                                 

Gene name
uchl1, cb358, wu:fc55h08
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     325119 (uchl1)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   325119 (uchl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MEWKPMEINPEMLNKVLSKLGVGSKWRFVDVLGLEDESLSGVPSPCCAMMLLFPLTQQHE
DFRSKQSVGDCKDVYFLKQTVVNSCGTVGLVHAVANNQDSIDFDNNSALKKFLEATSGMS
PAERAKELEQNKAIQETHDAVADEGQCRPEADKVNFHFITFVNVDGRLYELDGRIDGPVS
HGPTKPDSFVMDAARVCREFMEREKGEVRFSAVALCKA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaaaccgatggaaataaacccagagatgctgaataaggtgttgagcaagctg
ggtgtgggctcgaaatggcgttttgtcgatgttttgggtctagaagatgaatctttgtca
ggagtgccctcaccctgctgtgccatgatgctgctcttccctttaacgcaacagcatgag
gatttccgttctaaacaatctgttggtgactgtaaagatgtgtattttctgaaacaaact
gtggtcaactcctgtggaactgtgggcttggttcatgctgtggccaacaaccaggacagt
attgattttgataataattctgcactaaagaagtttctagaagccacctcagggatgtct
cctgcagaacgagccaaagaacttgaacaaaataaggctatccaagaaactcatgatgct
gttgctgatgagggtcagtgtcggccagaggcagacaaagtcaatttccattttattaca
tttgtcaatgtagacggtcgcctttatgagctggatggtagaattgatggacctgtgagt
catgggcctacaaaaccagacagctttgtcatggatgcggcaagggtgtgccgtgagttt
atggagcgagagaaaggggaggtgcgtttctctgctgttgctctctgcaaagcctga

DBGET integrated database retrieval system