KEGG   Danio rerio (zebrafish): 325361Help
Entry
325361            CDS       T01004                                 

Gene name
chp1, chp, si:dkey-41n20.1, wu:fc69b04, zgc:63904
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dre  Danio rerio (zebrafish)
Brite
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     325361 (chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 194 aa AA seqDB search
MGSRASSLLREEDIEEIKKETGFSHSQITRLYSRFHSLDKGENGGLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPVEDNEKNKDLTGEPLNSRTNKLLFAFRL
YDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDMCISFNEFTKVLE
KVDVEQKMSIRFLH
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggctccagagcttcgtctttactcagagaagaggacattgaagagattaagaaagaa
actggattctctcacagtcagatcactcgcctctacagccgctttcacagtttggacaaa
ggagaaaacggaggactcagccgtgaagacttccagaggattcctgagttggctataaat
cctctcggcgatcggataattaatgccttcttcccagagggtgaggatcaggtgaacttc
agaggcttcatgaggactctggctcatttccggcctgtggaggacaatgagaagaacaaa
gacctgacaggagagccgctcaacagcagaaccaacaaactgctctttgcattccggtta
tatgacctcgacagagatgacaagatctccagagatgagctgctccaggtgctgaggatg
atggtaggagtgaacatttcagatgagcagttgggaagcatcgcagacagaacaatccag
gaggcagacactaatggagacatgtgcatctccttcaacgagttcaccaaggtattggaa
aaagtggatgtcgaacaaaagatgagcatccgtttccttcactga

DBGET integrated database retrieval system