KEGG   Danio rerio (zebrafish): 325631Help
Entry
325631            CDS       T01004                                 

Gene name
usp24, wu:fc94c01, wu:fm69d03
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
20
AA seq 2589 aa AA seqDB search
MMETEEEQHMTTLLCMGFPDPVAIRKALRLAKNDINEAVALLTNESPGLGYGYEPMESGP
SPGSGDGENSGRTVTGGFDPPPAYHDVVESERSNDENGNCSGNSMEFPTTNLYELESRVF
TDHWSIPYKREESLGKCLIASTCLARHGLADADENCKRFIDRCMPEAFKKLLTSSAVHKW
GTEIHEGIYNMLMLLVDLVAERVKQDPIPIGLMGVLTMAFNPDNEYHFKNRMKACQRNWA
EVFGEDSMFAVSPSSSYQKEPHGWLVDLVNRFGEMGGFTAIQCKLNQEEIEIGCVSALVQ
PLGVCAEYLNSSLVQPMLDPVIHKMITYVQNLEEKDLKDKRLVSIPELLSAIKLLCMRFQ
RELVNVVDDLRLDILLRMLKTPHFSAKMNSLKEVTKLIEESTVSKTVKNAIDTDRLLDWL
VENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELSKIWKIQAGQSSTVIENIHTI
IAAAAVKFNFDQLSHLFVLIQKSWEVESDRVRQKLLSLIGRIGREARSEATTGKVLEVLW
ELAHLPTLPTSLVQQALEEHLTILSDAYAVKETIKRNYIIKCIEDIKKSSQQTNPQTVWV
VPALRQLHEITRSFIKQTYQKQDKSIIQDLKKNFEIVKLITGSLVSCHRLAVSVAGSNGL
SGSTLVDGRYSYQEYLEGHLKFLAFFLQEASLYLVWNRAKEIWECLVSGMDVCELDREMC
FEWFTKGQHDLESDVQQQLFKEKILKLEPYEITMNGFNLFKTFFENVNLSDHRLKRQGTQ
LCVERLDLAGMDFIWRIAMESPDEDIANEAIQLIITYSYINLNPKMKKDSVSLHKKFIAD
CYKRLEAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPSRSSKLVIIERLLLLAE
RYVITIEDLYSVPRTILPHGASFHGHPVTLHITYESTKDTFTLEAHSNETIGSIRWKIAD
QLSCPVDNVQIFANDSMLTMNRDQKLLNQLGFSDEQSLTVKSSGTGTPSGSSADSSASAS
SSSSGVFNSAYALEQEKSLPGVVMALVCNVFEMLYQLANLEEPRITLRVRKLLLLIPTDP
EVQDALDNFVPKESSVWSHQKTLFTLGSGSQASKSPSLSSKQQHQQSAASILESLFRSSA
PGMSTFRVLYNLEVLSSKLMPTSDDEMAKTSVKSFCENFLKAGGLSLVVNVMQRDSIPSE
VDYETRQGVYSICLQLARFLLVGQAMPSILDEELSKDDTLSSRPFRNAGRQSGRQLSVCG
TPEKSSYRQVSVSDRSSIRVEEIIPAARVAIQTMEVGDFTSTVACFMRLTWAAAAGRLDL
VGSSQPIRETTNSLLPLGVRSRVSSTGSNCSSSSEGEVTTLQAGICVKQLFVSIKDTIIA
REALSLLVTCLQLRSQQLCSFYSLLSVNDFIIDILLGSPSGEIRRVACDQLYTLSQSDTS
AYPDLQKPNLFLLKVVLTAQLPLWSPTSIMRGVNQRLLSQCTEYFDLRCQLLDDLTTSEM
EQLQIGPAAMLEDEISWLDNFEPTWTTELETSEADNILLAGHLRLIKTLLSLCGTEKEQF
GPSLIQQLLDDFLFRASRIILNSDSSSSTTASIHDFHPKCSTVSSRLAAYEVLVMLADSS
LTNLQLITKELLSMHHQSDPSLSKEFDYLPPVDSRSISGFVGLKNGGATCYMNAVFQQLY
MQPGLPEGVLSIEDDTENPEESVFCQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYV
REQQDAYEFFTSLVDQLDEHLKKIGREQIFKNTFQGIFSDQKICKDCPHRYEREETFMAL
NLGVTSCQSLEISLDQFVRGEVLDGSNAYYCEKCKEKRTTVKRTCIKSLPSVLVIHLMRF
GFDWESGRSIKYDEQIRFPWVLNMEPYTVSGMARQDSSADHGENGRGGEAGSGGSPRKKV
TISENYELVGVVVHSGQAHAGHYYSFIKDRRGSARGRWYKFNDNVVEEFDMNDETLEYEC
FGGEYRPKVYDQSNPYPDVRRRYWNAYMLFYQRISDQNSPVLPKKSRVSIMRQEAEDLSL
SAPSSPEISPQSSPRPPRANNDRLTLLTRLVKKGEKKGLFVEKMPARIFQMVRDENLKFM
KNRDVYNSDYFSFTLSLASVNATKLKHASYQAMAKTSLQLAVQFLLHTYLRTKKKLRVDT
EEWIATVEVLLSKSSEACQWMVQYLVAPEGREIIKICLLECSVREVRVVVATILEKTLES
ALYFQDAGLDCLLDMLLSLLDKDVPDNCKNCSQYFSLFSNFAQRGCGPCQLLLKHSAYRR
MLVFLLGPNRQNNQHRRWSSAQAREFLHLHNTLALMVLHTDLTSQRTEAQGVFKQASSGL
VAPSSVLMPLHPDINTLLFKADGQAYLMEVMFAMRELSGPLSFLIEMITYSSFCNEPFSL
GVLQLLKNHLETAPPHELKNVFQMLLEILMLEDPLQSQRLKFAFESEKGLLALMHQSNNV
DSSRCYQCVKFLVTLAQKCSPAKDYFKELSGHWSWAVQWLQKKMSEHYWTPQSNVSNETS
TAKTFQRTISAQDTLAYATALLNEKDQSGSSNGSDGSPANENSDRSLRQGSESPMMLGDS
RSDLEDVDP
NT seq 7770 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaccgaggaggagcagcatatgaccacgctcttgtgcatgggcttcccagac
ccggtggccatccggaaagccctgcgactggccaaaaacgacatcaacgaggctgtcgcg
ttgctcaccaacgaaagcccgggactaggatacggctacgagccgatggagagcggccct
tccccgggcagcggagatggcgagaacagcgggcgcacggtcaccggagggtttgatcct
ccgcctgcgtatcacgatgtcgtggaaagcgagaggagtaacgatgagaacgggaactgt
tctgggaacagtatggagttccccaccactaatctgtatgaactggagagcagagtgttc
actgatcactggtccatcccatacaagagagaggaatcactcggcaagtgcctcatcgcc
tccacctgcctggccagacatggcctggccgatgcggacgagaattgcaaaaggttcatt
gaccgctgcatgcctgaggccttcaaaaagctgctgacatctagtgcggtgcacaagtgg
ggaacggagattcatgagggaatctacaacatgctgatgctgctggtggatctggtcgca
gagagagtcaaacaagaccccatacccattggccttatgggagttcttactatggctttt
aacccagataatgagtatcactttaagaaccggatgaaggcctgtcagaggaactgggca
gaagtgtttggagaggacagcatgttcgcagtgtctcccagctccagctaccagaaggaa
cctcacggctggctagtggacttggtgaatcggtttggagaaatgggaggcttcacagca
attcaatgcaagctcaaccaggaagagattgagatcgggtgtgtatccgctctggttcag
ccactcggtgtgtgtgcagaatacctcaactcaagcctggtgcagcccatgctggaccca
gtcatccataagatgataacatatgtgcagaacctggaggagaaagacctgaaagacaag
cgtctggtgagtattcctgagctgctgtcggccattaagctgctctgcatgcgtttccag
cgggagttggtgaacgtggttgatgacctccggctggacatcctccttcgaatgctcaaa
acgccccatttcagtgccaagatgaactcgctcaaagaggtcacgaaactcatcgaggaa
agtacagtgtctaagactgtgaagaacgccatcgacacagaccgacttttggactggctg
gtggaaaactcagtgctgtcgatagctctggaaggaaacattgaccaggcccagtactgt
gacagaataaagggcatcattgagctgctgggcagcaagctctctttggacgaactctcc
aaaatatggaaaatacaggctggtcagtcctccactgtgatcgagaacatccacaccatc
atcgctgctgctgccgtcaagttcaactttgaccagctcagccacctctttgtccttata
cagaagagctgggaggtagaaagtgatcgcgtcagacaaaagctgctcagtcttattgga
cgaattggcagagaggctcgatctgaggcaaccacaggaaaggtgttggaggtattgtgg
gagttggcacatctgcccactctgcccacctctttagtgcagcaggctctggaagagcac
ctcaccatcctcagcgacgcttatgctgtcaaagaaaccatcaagaggaactacatcatc
aagtgcatcgaggacatcaagaagtcttctcagcagactaaccctcagacagtgtgggtt
gtgccagctttacggcagcttcacgaaatcacacggtcttttatcaaacaaacctaccag
aaacaggacaagagtataattcaggacctaaagaagaattttgagattgtgaagctgatc
acaggctccctggtgtcctgtcatcgattggccgtgtctgtcgctggatccaatggtctt
tccgggtccacactggttgatggacggtattcctatcaggagtatttggagggtcacttg
aagttccttgcgttcttcctgcaagaggccagtctgtacctggtctggaacagagccaaa
gagatctgggaatgcctggtatccggcatggatgtttgtgagctggatcgagagatgtgt
ttcgaatggttcacaaagggacagcatgatctagaaagtgacgttcagcagcagcttttc
aaagagaagatcctcaagctggaaccttacgagatcaccatgaatgggtttaacctcttc
aagaccttcttcgagaacgtgaacctcagtgaccaccgtctcaaacggcagggaacacaa
ctgtgcgtggagcgtttggatctggccgggatggactttatttggagaatcgcgatggag
tctccggatgaagacattgctaatgaagccatacagctcatcattacctacagctacata
aacctcaaccccaaaatgaagaaggattcagtgtctctacataagaagttcattgccgac
tgctataagagattagaggctgctagctctgcgctgggtgggccgaccctcacacacgct
gtaacccgggccaccaagatgttgacagccactgctatgccaacagtcgcaacgtcagtg
cagtctccatccaggtccagtaaactggtgatcatagagaggctcctgttattagcagag
cgctacgtcatcacaatagaggacctgtattcggttcctcgaactattctacctcatgga
gcgtctttccacggccatcctgttacacttcacatcacttacgaatctaccaaagacaca
ttcaccctggaggcccacagtaatgagactataggcagcatcaggtggaagattgcagat
cagctcagctgtccggtggacaatgtgcagatattcgccaatgacagcatgctgacgatg
aaccgtgaccagaagctgctaaatcagctgggtttctctgatgagcagagtctgacggtg
aagagctcaggaacaggcacgccgtcgggcagttcagcagacagctcagcctctgccagc
tccagcagcagcggcgtcttcaactccgcatatgctctcgaacaggagaaatctcttcct
ggtgtggtaatggcgctggtgtgtaacgtcttcgagatgctgtatcagcttgccaacttg
gaggaacccagaataactcttcgtgtgaggaagttgttgctgctcatcccgactgaccca
gaggtgcaggacgccctcgataactttgtgccaaaagagtccagcgtctggagtcaccag
aaaactctgtttacactgggatcgggttctcaggcctcgaagtcaccgtctctgtccagc
aaacagcagcaccagcagagcgcagcatctatcctggagtctctgtttcgctcctctgcc
ccgggcatgtccaccttcagagtgctctataacctggaggttttgagctccaagctgatg
cccacatctgatgatgaaatggccaagaccagtgtcaaatctttctgtgagaacttcctc
aaagcagggggtctcagtctggtggttaacgtcatgcagagagactccatcccgtctgag
gtagactacgagaccagacagggagtctattccatctgcctgcagctggccaggttttta
ctggtagggcaggctatgcctagtatcctggacgaggagttaagcaaggatgacactctg
tcctctcggccgtttcgtaacgctggccgtcagagcggccgtcagctctccgtctgtgga
actccagaaaagtcctcctaccggcaggtgtccgtgtctgacagatcctccattagagtg
gaagaaatcatcccagccgctcgtgttgccatacagacaatggaggtaggagacttcaca
tctacagttgcgtgtttcatgagactcacctgggcagcagctgcaggccgattggacttg
gttggcagcagtcagccaatcagggagacgaccaactctcttctcccgctgggcgtccgc
agcagagtcagcagcacaggaagtaactgcagttccagcagtgagggtgaggtgaccaca
ctgcaggctggcatatgtgtcaaacagctgtttgtgtccattaaagacaccatcatcgca
cgagaagcactctctttactcgtcacatgcctccagctacgctcccaacagctatgttca
ttttactctctgctgtctgtgaatgatttcatcattgatattctgctgggctcgccgagt
ggggagatccggcgtgtggcgtgtgatcagctctacacactcagtcagtcggacacttca
gcgtacccggacctccaaaagcccaacctcttcctgctgaaggtggtcctgacagcacaa
cttcctctctggtcgcccaccagcatcatgaggggcgttaaccaaaggttgctttcacaa
tgcacagagtattttgacctgagatgccaactgctggatgacctgacaacctcagaaatg
gagcagcttcagatcgggccagcagcgatgctggaggacgagatcagctggctagataat
ttcgagcccacctggactaccgagctggagaccagtgaggctgacaacatcctgctggcc
ggacacctgcgcctcatcaaaaccctgctgtccctctgtggcactgagaaagaacagttc
ggtccttccctgatccagcagctgttggacgactttctgttcagagcctctcgaatcatc
ctgaacagtgacagctcctctagcactacagcatctatacatgactttcaccccaagtgc
agtacagtcagtagtcgtctggcggcatatgaagtgctggtcatgttggctgacagctct
ctgactaacctgcagctcatcactaaagagctgctgtccatgcaccatcagtctgaccca
tctctcagcaaagaatttgactatcttcctcctgtagacagtcgctctatttctgggttt
gtgggtctgaagaacggcggtgcgacctgctacatgaacgcagtgtttcagcagctctac
atgcagcctggtttgcctgagggtgtcttgtcaattgaagatgacactgaaaacccagag
gagagtgtcttctgtcaggtccagtctctgtttggtcacctgatggagagcaaactgcag
tattatgtacccgagaacttctggaagatctttaagatgtggaataaagagttatatgta
cgagaacagcaggatgcctatgagttcttcaccagtctggtggatcagcttgatgaacat
ctgaagaaaatcggcagagagcagatcttcaagaacacatttcaaggcattttctccgac
cagaagatatgcaaagactgtccacacaggtatgagcgtgaggagaccttcatggctctg
aatttgggtgtgacgtcctgtcagagtctggaaatctctctggatcagttcgtcagaggg
gaagtgctggacggcagcaatgcgtattactgcgagaagtgtaaagagaagaggaccact
gtaaagcggacctgtataaagtccctgcccagtgtgctggtcattcacctcatgagattc
ggctttgactgggagagcggacgctccatcaaatatgacgagcagatcagattcccgtgg
gtgctgaacatggagccctacactgtgtcaggaatggcccgccaggattccagtgcagat
catggagagaatgggagagggggtgaggccggatccgggggatcacctcggaagaaagtc
accatctctgagaactacgagctggtgggagtggtggtccacagcggacaggcccatgcc
ggacactattactccttcatcaaagaccgccggggtagtgcacgaggacgctggtataag
tttaacgacaatgttgtggaagagtttgacatgaacgatgagactctggagtacgagtgt
tttgggggggaatacagacccaaagtttatgaccagtcaaacccttacccggatgtgcga
cgacgctactggaatgcctacatgctgttctaccagcgcatcagtgaccagaactcaccc
gtcctgcccaaaaagagccgtgtcagcatcatgaggcaagaagcagaggatctctctctg
tcagcaccctcctctccggagatctcaccccagtcttctccacgaccacccagagccaac
aacgaccggctcaccctgcttacacgcctggtcaagaaaggagaaaagaaaggtctgttt
gtggagaagatgcccgccaggatctttcagatggtgagagatgaaaatctgaagtttatg
aagaacagagatgtttacaacagcgattatttcagcttcacgttgtctctggcctctgtc
aacgctacaaagttaaagcatgcatcatatcaggccatggctaagaccagtctgcagttg
gccgtccagttcctcctccacacatacctgcgcactaaaaagaaactcagggtggacaca
gaggagtggatcgccactgtggaggttttgttgtccaagagcagcgaggcttgtcagtgg
atggtccagtatctggtggcacctgaaggacgggagatcatcaagatctgcctgttggag
tgcagtgtgcgagaggtgcgtgttgtagtggccactatcctggagaagaccttagagagt
gctctctacttccaggatgctggtttggactgtctgctggacatgctcctgtctctgctg
gataaagatgtcccggacaactgcaagaactgctctcagtactttagcctctttagcaac
tttgctcagaggggctgtgggccttgtcagctgcttctcaaacattcagcttatcgccgc
atgctcgtcttcctcctgggacccaaccggcaaaacaaccagcatcggcgctggagttca
gcccaggctcgagagttcctgcatctccacaacactctggccctcatggtgcttcacact
gacctcacatctcagaggacggaagctcaaggagtgttcaagcaggcctcatcaggtctg
gtggctccgtcttcagtcctcatgcctctccatccagacatcaacactctgctctttaag
gctgatggacaggcatatctgatggaggtgatgtttgccatgcgcgagttgtccggccct
ttgtcctttctcatcgagatgatcacctacagctccttctgtaatgaacctttctcactt
ggagtcctgcagttactcaagaatcatctggaaacagctcctcctcatgaactaaagaac
gtctttcagatgctgctggaaatcctgatgttagaagatcccctgcagtctcagagactc
aaatttgcttttgaatctgaaaaaggtcttctggctttgatgcatcagagcaacaatgtg
gacagcagtcgctgctaccagtgtgtgaagttccttgtcacactggcacaaaaatgttct
ccagctaaggattattttaaggagctctcaggacactggagttgggcagtgcagtggctt
cagaagaagatgtctgagcactactggactcctcagagtaacgtatcgaatgagacgtcc
acagctaaaaccttccagcgcactatttcagcacaggacacgctagcctatgccacagct
ttactaaatgagaaggatcagtccggcagcagtaatggatctgacggcagtccagccaat
gagaactcagaccgaagcctcagacagggatccgaatccccaatgatgctgggtgactct
cggagtgatctagaagacgtggacccataa

DBGET integrated database retrieval system