KEGG   Danio rerio (zebrafish): 326722Help
Entry
326722            CDS       T01004                                 

Gene name
fe11b02
Definition
wu:fe11b02
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   326722 (fe11b02)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
7
AA seq 124 aa AA seqDB search
MPEPAKTAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaccagcgaagactgcacccaagaagggctccaagaaggcggtgactaaaacc
gccggcaaaggaggaaagaagcgcaagaggaccaggaaggagagctatgccatctacgtg
tacaaggtacttaagcaggttcaccctgatactggaatctcttcgaaggcgatgggcatc
atgaactccttcgtcaacgacatttttgaacgtatcgccggtgaggcgtctcgtctcgct
cactacaacaagcgctccaccatcacatcgagagagatccagaccgccgtccgtctgctg
ctccctggagagctggccaaacacgccgtgtctgagggcacaaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system