KEGG   Danio rerio (zebrafish): 327165Help
Entry
327165            CDS       T01004                                 

Gene name
pgam1b
Definition
(RefSeq) phosphoglycerate mutase 1b
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00260  Glycine, serine and threonine metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01230  Biosynthesis of amino acids
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dre_M00002  Glycolysis, core module involving three-carbon compounds
dre_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    327165 (pgam1b)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    327165 (pgam1b)
Enzymes [BR:dre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     327165 (pgam1b)
Membrane trafficking [BR:dre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    327165 (pgam1b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   327165 (pgam1b)
  Exosomal proteins of melanoma cells
   327165 (pgam1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 327165
NCBI-ProteinID: NP_958457
ZFIN: ZDB-GENE-030131-5376
Ensembl: ENSDARG00000014068
Vega: OTTDARG00000021881
UniProt: B8A4H6
Position
1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESVWNQENRFCGWFDADLSDTGEAEAKRGGQALKDAGYEFDICYTSVL
KRAIRTLWLVLDGIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
IPPPPMDPEHDFYTAISKDRRYGDLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPVKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctataagctggtgctgatccgccacggagagagcgtctggaaccaggagaac
aggttctgcggatggttcgacgccgatctcagcgacaccggagaggcggaggccaagaga
ggtggacaggccctgaaagatgcgggttacgagtttgacatctgctacacatcagtgctg
aagcgagcgatcaggactctgtggctggtgctggacggcattgatcagatgtggctgccg
gttcaccgcacctggcgtctgaacgagcggcactacggcggcctgacgggtcttaataaa
gctgaaaccgcagccaaacatggagaggcacaggtcaagatatggagacgctcctacgac
attcctcctccacccatggaccccgagcacgacttctacaccgccatcagcaaggaccgg
cgttacggggacctgacggaggatcagctgccctcctgcgagagcctaaaggacaccatc
gctcgagcactgcccttctggaatgaggagatcgtcccgcagatcaaggagggaaagagg
gtcctcatcgcagcccacgggaacagcctgagaggaatcgtcaaacacctggagggaatg
tcggaggaggcgattatggagctcaatctgcccacggggatccccatcctgtacgagctg
gacaagaacctgaagccagtgaagcctatgcagttcctgggagatgaagagaccgtccgc
aaggccatggaggctgtcgctgcgcaggggaaagcaaagaagtag

DBGET integrated database retrieval system