KEGG   Danio rerio (zebrafish): 327165Help
Entry
327165            CDS       T01004                                 

Gene name
pgam1b, fd15c02, pgam1lb, wu:fd15c02, zgc:63722
Definition
phosphoglycerate mutase 1b
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dre00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESVWNQENRFCGWFDADLSDTGEAEAKRGGQALKDAGYEFDICYTSVL
KRAIRALWLVLDGIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
IPPPPMDPEHNFYTAISKDRRYGDLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPVKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctataagctggtgctgatccgccacggagagagcgtctggaaccaggagaac
aggttctgcggatggttcgacgccgatctcagcgacaccggagaggcggaggccaagaga
ggtggacaggccctgaaagatgcgggttacgagttcgacatctgctacacatcagtgctg
aagagagcgatcagggctctgtggctggtgctggacggcattgatcagatgtggctgccg
gttcaccgcacctggcgtctgaacgagcggcactacggcggcctgacgggtcttaataaa
gctgaaaccgcagccaaacatggagaggcacaggtcaagatatggagacgctcctacgac
attcctcctccacccatggaccctgagcacaacttctacaccgccatcagcaaggaccgg
cgttacggggacctgacagaggatcagctgccctcctgcgagagtctaaaggacaccatc
gctcgagcactgcccttctggaatgaggagatcgtcccgcagatcaaggagggaaagagg
gtcctcatcgcagcccacgggaacagcctgagaggaatcgtcaaacacctggagggaatg
tcggaggaggcgattatggagctcaatctgcccacggggatccccatcctgtacgagctg
gacaagaacctgaagccagtgaagcctatgcagttcctgggggatgaagagaccgtccgc
aaggccatggaggctgtcgctgcgcaggggaaagcaaagaagtag

DBGET integrated database retrieval system