KEGG   Danio rerio (zebrafish): 327239Help
Entry
327239            CDS       T01004                                 

Gene name
usp36, wu:fd19b04
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     327239 (usp36)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   327239 (usp36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 707 aa AA seqDB search
MPIVDKLKEALKPGRKDPGDEGDLNKLLASSAKKVLLQKIEFEPASKGFSYQLETLKTKY
VILNPKNDAATSQRPTEPAQIKRQISESLSVGQSDGIPAPQKMLFPGNKLSMKWERVYRV
GAGLHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHSRSCHQSGFCMICVMQNHIIQAFAN
TANAIKPVSFIRDLKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTL
VHQIFGGYLRSRVKCSICKSVSDTYDPYLDIALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPATKRFTVHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSMVHSSNIKVVLNQQAYVLFY
LRIPEKKNTDAKQNMVHSGRTNMTPEQLKKSTLNGPLSSPQVTKKLDPAQLRKIQSVDGG
LGVPVARNCSGLQSPKLSNGTSNSHALLKPASGPSLIEEPLKKVKKPTAQPHSRSSTPAP
SSGLHKTNSKQLPSSTSLKSLSDSSSADTSSSSESRESVGTRSAPAGDPSSVNSPASPAK
STEEQKKLKPQALTNVTSEPISTMSPPPAKRLALSAKKASVRQSLSSSTEARPPSSFHLS
SDPTHFLSPASLHPHHRNQLSLFKLRNSLSCHTKSRLSFLFHTNFSH
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgccgatagtggacaagctcaaagaggccctgaagccgggacgcaaggaccctggtgat
gagggcgacctgaacaagctgctagcttcatccgccaagaaggtgttgctgcagaagatc
gagtttgagccggccagcaaaggcttcagctaccagctggagaccctcaaaaccaaatat
gtgatcctgaaccctaagaatgatgcggccacatcgcagagacctactgaacctgctcag
attaagaggcaaatctcagagtctctgagtgtcgggcagagcgatggcatccccgctccg
cagaagatgctctttccagggaacaagctgtccatgaagtgggaacgggtgtatcgggtt
ggagccggcctccacaacctgggcaacacctgcttcctcaactccactgtgcagtgtctg
acctacaccccgccgctggccaactacctgctgtccaaggagcacagccgatcctgtcac
cagtccggattctgcatgatttgcgtgatgcagaaccatatcattcaagcctttgccaac
acagccaatgccatcaaacctgtatctttcatccgggatctgaaaaagatcgctcggcat
tttcgatttggcagtcaagaggacgcccatgagtttctgcgttacactattgatgccatg
cagaaagcttgtttgaatggttatcctaagctggacaggcagacgcaggccaccacacta
gtccaccagatatttggaggatatttgaggtcaagagtgaaatgctctatttgtaaaagc
gtttccgatacctatgacccctacctggacatcgctctggagattcggcaagcagccaac
atcgttcgtgctctggagctgttcgtcaagcctgatgttttgagcggagagaacgcctac
atgtgtgccaaatgtaagaagaaagttccagctaccaagcgcttcacagttcacagaacc
tcaaatgtgctcacgctgtcgctgaaaaggtttgccaacttcagtggagggaaaattacc
aaggatgtcggctacccggagttcctgaacattcgtccgtacatgtcacagagcagtgga
gatccggtgatgtacggcctgtacgcggtcctcgtgcattcagggtacagctgccatgct
gggcattactactgctacgtcaaggccagtaatggacagtggtatcagatgaacgactcc
atggttcattccagtaacatcaaggttgttcttaatcagcaggcctatgtgctcttctat
ttgaggattcctgaaaagaaaaacacagatgcaaagcagaacatggtgcactctgggaga
actaacatgacaccggagcagctgaagaaaagcacacttaatggacctttgtcttcaccc
caggtcacaaagaagctagatccggctcagctgagaaagatccagtcagtggatggaggt
cttggtgttcctgttgccaggaactgttcgggactccagtcgccgaagctgtctaatggg
acgagcaactctcatgccctgctcaaaccggccagtggaccctcgcttatagaagaaccc
ttgaagaaggtgaagaaacccacagctcagcctcactcccgcagcagcactcctgctcca
tccagcggcctccacaaaaccaacagcaaacaactgccgtcatctacctcactcaaatct
ctgtccgactcctcctcagcagacacctcctcctcctccgagtccagagagtctgttggt
acaaggagtgctcccgctggagatccgtcaagtgtgaacagtccagcatctccagccaag
agcacagaggagcagaagaaacttaaaccgcaggccctcaccaatgtcacatcagagcct
atcagcaccatgtcgccgccgcctgccaaacggcttgccctgtcagccaagaaggccagt
gtccggcagagcctgagcagcagcactgaggctcggcccccttcatcttttcatctgtcc
agtgaccccacacactttctcagcccagcctcgctccacccgcaccacagaaaccaactc
tccttgttcaaattacgaaattccctcagctgtcacacgaaaagtaggttgtcttttctt
tttcataccaatttttcccattga

DBGET integrated database retrieval system