KEGG   Danio rerio (zebrafish): 327301Help
Entry
327301            CDS       T01004                                 

Gene name
ppp1cab, Ppp1ca, fb18b03, fd20h04, wu:fb18b03, wu:fd20h04, wu:fl22a03, zgc:55744, zgc:76940
Definition
protein phosphatase 1, catalytic subunit, alpha isozyme b (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    327301 (ppp1cab)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    327301 (ppp1cab)
  Cell growth and death
   04114 Oocyte meiosis
    327301 (ppp1cab)
  Cellular commiunity
   04510 Focal adhesion
    327301 (ppp1cab)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    327301 (ppp1cab)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    327301 (ppp1cab)
   04270 Vascular smooth muscle contraction
    327301 (ppp1cab)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    327301 (ppp1cab)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     327301 (ppp1cab)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     327301 (ppp1cab)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     327301 (ppp1cab)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    327301 (ppp1cab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 332 aa AA seqDB search
MAESDKINIDSIIQRLLEVKGSRPGKNVQLTEQEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKVLSYGGAGGFGNSRPVTPPRNTAKGGKAKK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatcggacaaaataaacatcgattcgatcatccagcgccttttggaagtgaag
ggctcaagacctggtaaaaatgttcagttaactgagcaagagattcgaggattgtgtcta
aaatctcgagaaatctttcttagtcagccaatactactggagctggaggcacccctcaag
atttgtggtgatgttcatggtcagtactatgacctgctcaggctttttgagtatggagga
tatccaccagagagtaactacctatttctgggagactatgttgacagaggcaagcagtca
ctggagaccatctgcctgctgcttgcttacaagatcaaatatccagagaacttctttctt
ctcagaggaaaccatgaatgtgcctcaatcaacaggatatatggattttatgatgaatgt
aaaagacgttataacatcaagctctggaaaacattcacagactgtttcaactgcttgcca
gtagctgctattgtggatgaaaagattttttgttgtcatgggggtctttctccagacctg
caatcaatggaacagattcggcgtgtgatgaggcctacggatgtccctgaccagggtttg
ctgtgtgatctgctctgggctgaccctgataaagatgtcatgggctggggagagaatgat
cgtggtgtttccttcaccttcgggtctgatgtcgtggccaagtttttgcacaaacatgac
atggatctcatatgcagagcccaccaggtggtggaggatggctacgagttctttgcgaag
aggcagttagtcacgcttttctctgctcccaactactgcggcgagtttgacaatgcaggt
gccatgatgagtgttgatgagacccttatgtgctcatttcagattctgaaaccagcagag
aagaaggtgctgtcatatggcggcgctggaggatttgggaacagcagacctgtaactcct
cctcggaacacagccaagggtggcaaagccaagaaataa

DBGET integrated database retrieval system