KEGG   Danio rerio (zebrafish): 327599Help
Entry
327599            CDS       T01004                                 

Gene name
chp2, wu:fi19e07, zgc:55363
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
dre  Danio rerio (zebrafish)
Brite
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     327599 (chp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 195 aa AA seqDB search
MGSSSSTLLKKIPNVDELMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAM
NPIGDRIIDAFFSPGKDTVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQ
LYDQDKDGKISRDELLKVLRDMLGLQVTEEQLESIADRTIQEADLDRDDAISFEEFRKSL
EKVNIDHKMSIRFLR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtcgagctccaccctattaaaaaaaatcccaaacgtcgacgagttgatgcaa
gaaacgggcttttcgcctgcccacattattcgcctgtatgaacgctttgaagctctggat
aaagaacgacgaggccatctctgtccacaggattttggagccataaaggagctggcaatg
aaccccataggagacagaataatagatgccttcttctccccaggaaaggacacggtggat
tttcacacttttgtaaagatcctggctcatttccggcccgttgacaaggatcgacccaaa
gagcccaattctcctgaacctatcaacagcaggagcaacaaactcaaatttgcgtttcag
ctgtatgaccaggacaaggatggcaagatttccagggatgagcttttaaaggttctgcgg
gacatgctgggactgcaggtgaccgaggaacagctggagagcattgcagaccgaacgata
caggaagcagatctagaccgcgatgatgctatatcttttgaggagtttcgcaagtctcta
gagaaggtcaacattgatcacaagatgagcattcgcttcttgcgctag

DBGET integrated database retrieval system