KEGG   Danio rerio (zebrafish): 334420Help
Entry
334420            CDS       T01004                                 

Gene name
ugp2b
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase isoform 1
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    334420 (ugp2b)
   00052 Galactose metabolism
    334420 (ugp2b)
   00500 Starch and sucrose metabolism
    334420 (ugp2b)
   00520 Amino sugar and nucleotide sugar metabolism
    334420 (ugp2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     334420 (ugp2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
17
AA seq 554 aa AA seqDB search
MLLVKHFRSVPMTRTAAFREKKVGWLARKTRRCSGTTFSSCPTASSSSLQSLSKELLSNS
NGMAQFQEVMRQQLESSMHVELEKLLSTAKGAGAEVSKKDFEGFRKLFHRFLQVKGPSVE
WPKINRPPEDSIQPYDKIKAKGLPDNIADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRN
ENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYP
RINKESLLPVAKDMGMTGENGDVWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDN
LGATVDLYILNHLVSQPNGKRCEFIMEVTDKTRADVKGGTLIQYDGKLRLLEIAQVPKAH
VDEFKSVTKFKIFNTNNLWISLSAIKRLQEQNAMDMEIIVNPKTIDGGLNVIQLETAVGA
AIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSEKREFPTTPHVKLGS
SFTKVQEYITRFESIPDMLELDHLTVSGDVTFGKHVSLKGTVIIIANHGDRIDIPAGSML
ENKIVSGNLRILDH
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgttattagtaaagcacttccgcagtgtgcctatgacccgcactgctgctttccgagag
aagaaagttggttggctagcgaggaaaacacgtcgctgttccggaacaaccttcagcagc
tgcccaacagcatcctcctccagcttgcagagtctcagtaaagagttattgagcaactcc
aacgggatggctcagtttcaggaagtgatgcgacagcagctggagagctctatgcatgtt
gagctggagaaactcttaagcacagccaaaggtgcaggtgctgaggtctctaaaaaggat
tttgaaggcttcaggaagttattccaccgatttctccaagtcaagggaccttcagtagag
tggccgaaaatcaacaggccccctgaggactctatccagccatatgacaagatcaaggcg
aagggtctacctgacaacatagcagacagtctgaataagctggtggtggtgaagctgaat
ggaggtctgggaaccagcatgggctgcaaagggcccaagagcctcattagtgtccgcaac
gaaaacactttcttggacctaactgttcaacagatcgagcacttaaataaaacgtataac
gctgatgttccattggtgctcatgaactctttcaatacggatgaagataccaagaagatc
ctacagaagtacacgcaccacagagttaagatacacactttcaaccagagcaggtatcca
cgaataaataaggagtctttgttgccagttgctaaggacatgggtatgacaggagagaat
ggagatgtgtggtatcctcctggacacggtgacatttatgccagcttttataactctggt
ctgttggagcagctcatcgcagaagggaaagaatacatttttgtatccaacattgataac
ctgggtgcaacagtagatctgtatatactcaaccatcttgtgagccagcccaatggcaaa
cgctgtgagttcatcatggaggtcacagacaagactagagctgatgtaaagggaggtacg
ctcattcagtatgatggtaagcttcggttactggagattgcccaagttcccaaggctcat
gtagatgaattcaaatcagtgaccaagtttaagatattcaacaccaacaatctgtggatc
tctctatctgccataaagagactacaggaacagaatgccatggacatggaaattatagtc
aaccctaagacaatagacgggggattgaatgttattcagctggagaccgcagtgggtgct
gccatcaagtgctttgataacgccttgggcatcaacgtcccacgcagccgttttctgcct
gtcaaaaccacatctgacctcctgctggttatgtccaacctgtacagcctagatgcaggg
tctctcaccatgagcgagaaacgagagttccccacaactcctcacgtcaaactgggcagc
tccttcaccaaggttcaagaatatatcacacgctttgagagcattcctgacatgctggag
ctggatcacttgacagtgtctggtgatgtgacttttggaaagcatgtttctctgaaggga
accgttatcattatagcgaaccatggagatcgaattgacattccagctggctctatgtta
gaaaataagatagtgtccggaaaccttcggatcctggaccactga

DBGET integrated database retrieval system